KEGG   Bordetella avium: BAV2659Help
Entry
BAV2659           CDS       T00695                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bav  Bordetella avium
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BAV2659 (tpiA)
   01230 Biosynthesis of amino acids
    BAV2659 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BAV2659 (tpiA)
   00051 Fructose and mannose metabolism
    BAV2659 (tpiA)
   00562 Inositol phosphate metabolism
    BAV2659 (tpiA)
Enzymes [BR:bav01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     BAV2659 (tpiA)
Exosome [BR:bav04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   BAV2659 (tpiA)
  Exosomal proteins of bladder cancer cells
   BAV2659 (tpiA)
  Exosomal proteins of melanoma cells
   BAV2659 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2876095..2876844)
Genome map
AA seq 249 aa AA seqDB search
MTETANRRSRLVLGNWKMHGSLAENASLLAALRAADPALHCEIGVCVPFPYLAQASAALS
GSAISWGAQDVSAQAKGAFTGEVSASMLKDFGSRWALAGHSERRTLHGETDQEVADKARA
ALAAGLRPVVCVGESLAEREAGQTLAIIERQLAPVLALGREAVAGMVLAYEPVWAIGTGL
SATPEQAQEVHAAIRAALAGLGATQVQVLYGGSVKAANAASLFAMADIDGALVGGASLVA
EEFLRIAAN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaccgccaatcgtcgttcccgcctggtgctgggcaactggaagatgcatggc
agcctggccgaaaacgccagcctgctcgccgccttgcgcgccgccgaccccgccttgcac
tgcgagatcggtgtgtgcgtgccgttcccttatctggcgcaggccagcgccgcgttgtcg
ggcagcgccatttcctggggtgcccaggacgtcagcgcccaggccaagggtgcattcacg
ggcgaagtatccgcctcgatgctgaaagacttcggcagccgttgggctttggccggacac
tccgagcgccgcacgctgcacggcgagacggatcaagaggtggccgacaaggcgcgtgct
gcattggcagcgggtttgcgtcctgtggtttgcgtgggcgagtcgctggccgagcgcgag
gcgggccagaccctggccatcatcgagcgtcaactggctcccgtgctggccttgggccgc
gaggcggtggcgggcatggtgctcgcttatgagccggtgtgggcgattggcaccggtttg
tcggcaacgcccgagcaggcgcaggaagttcatgccgccattcgcgctgcgctggccggg
ctgggcgccacgcaggttcaagtgctgtatggcggcagcgtgaaggccgccaatgcggcc
agtctttttgccatggccgatatcgacggcgcgctggttggcggcgcttcgctggtggcc
gaagaattcttgcgcatcgccgcaaactaa

DBGET integrated database retrieval system