KEGG   Bordetella avium: BAV2767Help
Entry
BAV2767           CDS       T00695                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bav  Bordetella avium
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BAV2767 (gtaB)
   00052 Galactose metabolism
    BAV2767 (gtaB)
   00500 Starch and sucrose metabolism
    BAV2767 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BAV2767 (gtaB)
Enzymes [BR:bav01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BAV2767 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2992249..2993088
Genome map
AA seq 279 aa AA seqDB search
MKPVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITDLIFVTGRN
KRAIEDHFDTAPELETDLEKKAKYELLALVRDILPAHVHCIYIRQSAPLGLGHAVLTAAP
VVGDEPFAVLLADDLIDGDTPALAQLIACAAEQDGSVLGVQEVPRKDTNKYGIVASSHIA
PRTERVSHLVEKPAPEDAPSTLAVVGRYVLEPQIFDHLRNTGKGAGNEIQLTDGIAAMMR
ERAVYAYRYEGQRYDCGSKAGMFQATVALGRKYHGLIPE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgtgcgtaaggccgtcttccccgtagcaggcatgggcacccgtttcctgcca
gccaccaaggccatgcctaaggaaatgctgcccgtcgtggacaaaccgctgatccaatat
gccgtcgaagaagccgtcgccgccgggatcacggacctgattttcgtcaccggccgcaac
aagcgcgcgatcgaagaccacttcgacaccgcgcccgaattggaaaccgatctggaaaaa
aaggctaagtacgaactactggctctggtgcgcgacatcctgcctgctcacgtccactgc
atctatatccgccaatcggccccgctaggcctgggccatgcagtgctgaccgccgcgccc
gtggtcggagatgaaccgttcgccgtattgctggccgatgacttgatcgacggcgacacc
ccggcattggcgcaactgatagcctgcgccgccgagcaagacggtagcgtgctgggcgtg
caggaggtaccgcgcaaagacaccaacaagtacggcatcgtggcatcgagccatatcgcc
ccgcgcacggaaagggtttcgcatttggtcgaaaaacccgcaccggaagacgcgccctcg
accctggccgtcgtgggccgttatgtgctggagccgcagatttttgatcatctgcgtaac
accggcaagggcgctggcaatgaaatccagcttacggacggcatcgccgcgatgatgcgc
gaacgcgctgtctatgcctaccgctacgaaggtcagcgctacgactgcggcagcaaggct
ggcatgttccaggccacggtggccttgggccgcaaataccacggcctgatcccggaataa

DBGET integrated database retrieval system