KEGG   Bordetella avium: BAV2767Help
Entry
BAV2767           CDS       T00695                                 

Gene name
gtaB
Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bav  Bordetella avium
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:bav00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bav00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bav00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bav00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2992249..2993088
Genome map
AA seq 279 aa AA seqDB search
MKPVRKAVFPVAGMGTRFLPATKAMPKEMLPVVDKPLIQYAVEEAVAAGITDLIFVTGRN
KRAIEDHFDTAPELETDLEKKAKYELLALVRDILPAHVHCIYIRQSAPLGLGHAVLTAAP
VVGDEPFAVLLADDLIDGDTPALAQLIACAAEQDGSVLGVQEVPRKDTNKYGIVASSHIA
PRTERVSHLVEKPAPEDAPSTLAVVGRYVLEPQIFDHLRNTGKGAGNEIQLTDGIAAMMR
ERAVYAYRYEGQRYDCGSKAGMFQATVALGRKYHGLIPE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgtgcgtaaggccgtcttccccgtagcaggcatgggcacccgtttcctgcca
gccaccaaggccatgcctaaggaaatgctgcccgtcgtggacaaaccgctgatccaatat
gccgtcgaagaagccgtcgccgccgggatcacggacctgattttcgtcaccggccgcaac
aagcgcgcgatcgaagaccacttcgacaccgcgcccgaattggaaaccgatctggaaaaa
aaggctaagtacgaactactggctctggtgcgcgacatcctgcctgctcacgtccactgc
atctatatccgccaatcggccccgctaggcctgggccatgcagtgctgaccgccgcgccc
gtggtcggagatgaaccgttcgccgtattgctggccgatgacttgatcgacggcgacacc
ccggcattggcgcaactgatagcctgcgccgccgagcaagacggtagcgtgctgggcgtg
caggaggtaccgcgcaaagacaccaacaagtacggcatcgtggcatcgagccatatcgcc
ccgcgcacggaaagggtttcgcatttggtcgaaaaacccgcaccggaagacgcgccctcg
accctggccgtcgtgggccgttatgtgctggagccgcagatttttgatcatctgcgtaac
accggcaagggcgctggcaatgaaatccagcttacggacggcatcgccgcgatgatgcgc
gaacgcgctgtctatgcctaccgctacgaaggtcagcgctacgactgcggcagcaaggct
ggcatgttccaggccacggtggccttgggccgcaaataccacggcctgatcccggaataa

DBGET integrated database retrieval system