KEGG   Bordetella avium: BAV2778Help
Entry
BAV2778           CDS       T00695                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
bav  Bordetella avium
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bav00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BAV2778 (ruvA)
Enzymes [BR:bav01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     BAV2778 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3005217..3005789
Genome map
AA seq 190 aa AA seqDB search
MIGRITGTLIEKTPPVVYVDVNGIGYEIDVPMSTLYALPDTGARVTLFTHLVVREDAHLL
YGFGTASERAAFRELVKVSGIGARTALAVLSGMSVAELAQAITLQESGRLTRVPGIGKKT
AERLLLEMRGKLGADIGATPHAVPDSQSDILNALLALGYSEKESLAALKTLPEGLGVSDG
IRQALKALAR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgataggccgcatcaccggaaccctgatcgaaaaaacccctcccgtggtctacgtggac
gtcaatggcatcggctatgaaatcgatgtgcccatgagcacgctgtacgcgctgcccgac
accggcgcgcgcgtcacgctgttcacgcatctggtggtgcgcgaagatgcgcatctgctg
tatggctttggcacggccagcgaacgcgccgccttccgtgaactggtcaaggtcagcggc
atcggcgcgcgcaccgcgcttgcggtgctttccggcatgtcggtggcggaacttgctcag
gccatcacgctgcaagaaagtggccgtttgacccgggtacccggcatcggcaagaaaacg
gccgaacgcctgttgctggagatgcgcggcaaactgggcgcggacatcggcgccaccccc
catgccgtgccggacagtcagagcgatattctcaatgccctgctggccctgggttactcc
gaaaaagagtcgctggccgccctcaagacgctgccggagggcctcggcgtttcggacggc
atacgccaggccctcaaggccctggcgcgctag

DBGET integrated database retrieval system