KEGG   Bordetella avium: BAV2883Help
Entry
BAV2883           CDS       T00695                                 

Gene name
murE
Definition
putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase (EC:6.3.2.13)
Orthology
K15792  
murE/murF fusion protein [EC:6.3.2.13 6.3.2.10]
Organism
bav  Bordetella avium
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    BAV2883 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAV2883 (murE)
Enzymes [BR:bav01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.10  UDP-N-acetylmuramoyl-tripeptide---D-alanyl-D-alanine ligase
     BAV2883 (murE)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     BAV2883 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3134184..3137003)
Genome map
AA seq 939 aa AA seqDB search
MSPHFVRASEGSALPVLEVLRARVSASAHLRLDSRELSPGDVFIACRGVQGDGRAYIGSA
LDAGAAVVLYDSDALTQSVVADSRVLPVAGLRGMLGELADGWYGQPSASLTVLAVTGTNG
KTSCVQWLARALTRLGKPCGTIGTLGGLLPDGVSLGGNLTTPDVITLHRLMAQMRDAGAQ
AVAIEASSIGLEQGRMDSVRLIAAGYTNLTRDHLDYHGTMEQYEAAKALLFNWPGLQAAV
INADDAAGRRLLAKLPVGLASAYAIDHAEADVRAFDLQATAHGQVFTLATSEGQAQVVTG
LLGHHNVSNLLLVAGLLLRLGWPLAAVAREVAAAAPVDGRLQAVAPVGSAQGPLVVVDYA
HTPDALERALLALRPVAQARNGALVCLFGCGGDRDPGKRPEMGRIAGELADRIIVSSDNP
RSEAPQAIIDQVLAGVGPDLALRAESDRALAILHAIWDSWPEDVVLLAGKGHETYQEIAG
RRLAFDDREWARAALLLPHVAGVSTDTRSVAADEIFVAISGENFDGHRYLAQAQAAGACA
AVVAHRVSDSSLPQLVLGETRHALGRLATAWRARFSLPVIAVTGSNGKTTTKEMISAILA
AWQGEAHRLATSGNFNNDIGLPLTLLRLREGYRAAVVELGMNHPGEIAYLAPMAQASVAL
VNNAQREHQEFLHGVEAVARENGAVLSALPEDGVAVYPGDDVYTPIWDELAGARRVLRFG
LQPGLDVYAQKIRPDASGTLCQVVTPMGVADIVLPVPGEHNLRNALAAIACALAAGAPLA
SAVRALEGFSAVKGRMQRKETSNGTILIDDTYNANPDSVRVAIEVLAQLPGPRVLVLGDM
GEVGDEGPAMHREVGGYARDQGIDAMVTLGDASRAAAAEFGAGAHACASVDEVLAALRGM
NPFSVLIKGSRFMRMERVVTAFSASGDEAASGQEDKHVA
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
ttgagtccgcattttgttcgtgcatctgagggtagtgcgcttccggtactggaggttttg
cgggcacgtgtgtccgcgagcgcgcacctgaggctcgactcacgcgagctgagtcctggc
gacgtgtttattgcctgccggggagtgcaaggcgatggccgtgcttacatcggctcggct
ttggatgcgggcgccgccgtggtgctttatgacagcgatgcgctgacgcagagcgtggtg
gcggattcgcgtgtgttgccggtggccggcttgcgcggcatgctgggcgagttggccgac
ggctggtatggtcaaccctctgccagtctcacggttctggccgtgacgggcaccaatggc
aagacctcctgcgtgcaatggcttgcgcgggcattgacccgcctgggcaagccttgcggc
acgataggcaccttgggcggcttgttgccggacggcgtctcgctgggcggcaatctcacg
acgcccgatgtgataaccctgcaccgcttgatggcgcagatgcgcgacgcgggggcgcag
gccgtcgcgattgaggcctcctcgatcggtctggagcagggccgcatggacagtgtgcgc
ctgattgctgccggctataccaatctgacgcgcgaccatctcgattaccacgggaccatg
gagcagtacgaagcggcgaaagccctgctgttcaactggcccgggcttcaggccgccgtg
atcaatgccgatgatgccgctggccggcgtctgctggccaagctgcctgtcggtctggcc
agtgcttatgccatcgaccatgccgaggccgacgtccgcgcgttcgatttgcaggccacg
gctcatgggcaggttttcacactggcgacctccgagggccaagctcaggtcgtcaccggt
ttgctcgggcatcacaatgtctccaatctgctgctggtggcgggtttgctgctcaggctg
ggttggcccctggctgccgtggcccgcgaggtcgctgccgccgcgccggtagacgggcgt
ttgcaagccgtggcgcctgtcggttccgctcagggaccgctggtggtggtggattatgcg
catacgccggacgccctggagcgtgccttgctggccttgcggcctgtcgcgcaggcgcgc
aatggcgcattggtctgcctgtttggctgcggcggcgatcgtgacccgggaaaacggccc
gaaatgggccgtattgcaggtgagctggccgaccgtatcattgtttcaagcgacaatccg
cgcagcgaggcgccacaagccatcattgaccaggtgttggccggcgtcgggccggacctt
gccttgcgcgccgagtccgatcgggccctcgccattttgcatgcgatctgggacagctgg
ccggaagacgtcgtgctgctcgcgggtaagggtcatgagacctatcaggagatcgccggt
cgccgcttggctttcgatgatcgcgagtgggcccgggctgctttgctgctgccgcatgtc
gcaggggtttcgaccgacacacgcagcgttgctgctgatgaaattttcgtggcgatcagc
ggtgagaatttcgatggtcaccgttatctggctcaggctcaagccgctggtgcatgtgct
gcggtcgtcgcccaccgcgtgagtgattccagcctgccgcaattggtgctgggcgagaca
cgtcacgccttggggcgtttggccacggcctggcgcgcgcgcttcagcctgcctgtgatt
gccgtcacgggcagcaatggcaagaccaccaccaaggagatgatctccgccattctagcg
gcgtggcagggcgaggcgcatcgtctggcgacttccggcaacttcaataacgatatcggt
ttacccctgacgctgctgcggttgcgtgaggggtatcgtgccgccgtggttgagctgggg
atgaatcaccccggcgaaatcgcctatttggcgccgatggctcaggcctcggtggcgctg
gtcaacaatgcgcagcgcgagcatcaggagtttctgcatggcgtagaggccgtggcgcga
gagaacggcgcggtcttatccgctttgcccgaagatggcgtggccgtgtatcccggtgac
gatgtttacacccctatctgggatgagctcgcgggggcgcggcgggtgctgcgctttggc
ctgcagcccggtctggatgtgtacgcccagaaaattcgtcctgatgcttcgggcaccttg
tgtcaggtggtaacaccgatgggtgtggccgatatcgttttgcctgtacctggcgagcat
aatttgcgtaacgctttggcggcaattgcctgcgcattggctgctggagcgcctttggcg
agtgcggtgcgggccctggagggcttctccgccgttaaagggcgtatgcaacgcaaagaa
acgagtaacggaacaatcctcatcgatgacacctacaatgcgaaccccgactcggtgcgc
gttgccatcgaggtgcttgcgcagttgcctggtccacgagtgcttgtgctgggcgacatg
ggtgaagtcggggatgaggggcctgccatgcatcgtgaagttggcgggtacgcgcgcgat
caggggatcgacgcaatggtcacgctgggtgacgccagccgggcggctgcggccgaattc
ggtgcaggcgcgcacgcttgcgcatccgtagacgaagtccttgccgctttgcgcggcatg
aacccgttcagcgtattgattaaaggttcgcgctttatgcgcatggagcgggtagtgacg
gctttttctgcaagtggcgacgaggcggcctccggccaggaggacaagcatgttgcttga

DBGET integrated database retrieval system