KEGG   Bordetella avium: BAV3152Help
Entry
BAV3152           CDS       T00695                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bav  Bordetella avium
Pathway
bav00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01130  Biosynthesis of antibiotics
bav01230  Biosynthesis of amino acids
Module
bav_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BAV3152 (trpC)
Enzymes [BR:bav01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BAV3152 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: CAJ50761
UniProt: Q2KU99
Position
complement(3429220..3430008)
Genome map
AA seq 262 aa AA seqDB search
MNDILAKILAVKAEEVATARQMRSEAELLREAQARQDVRGFAQAIEDKIAQGKPGVIAEI
KKASPSKGVLRENFDASEIAASYAAHGAACLSVLTDVQFFQGSHDNLRRARAACPLPVLR
KDFILDPYQIISARAMGADCVLLIVAALSPTQLRDLEAVAMDLGMDVLVEVHDEAELDVA
LGMKTPLLGINNRNLRSFETRLETTLNLLPRIPAGKRVVTESGILQPDDVQLMRRHGVQA
FLVGEAFMRAEEPGAELARLVA
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacattctcgcgaagatcctagccgtcaaggctgaggaagtcgccaccgcccgc
caaatgcgcagcgaggctgagttgctgcgtgaggcgcaggcgcgccaggacgtgcgaggc
ttcgcacaggctatcgaagacaagatcgcccagggcaagcccggcgttatcgccgaaatc
aagaaggcgtcgccctccaagggcgtgctgcgcgaaaacttcgatgcttccgagattgcg
gcctcgtatgccgcccatggcgcggcctgcctttcggtcctgaccgacgtgcagttcttt
caggggtctcacgacaatctgcgccgcgcgcgcgcggcctgcccgctgcctgtgctgcgc
aaagatttcatcctcgatccttatcagatcatttcggcgcgcgcgatgggggccgactgt
gtgctgctgatcgtggcggcgctctcgcccacgcagttgcgcgatctcgaagccgtggcg
atggatctgggcatggatgtgctggtagaagtccatgacgaagccgagttggacgtggcc
ttgggcatgaagacgccgttgctgggcatcaataaccgtaatctgcgcagcttcgaaacc
cgtctggagacgacgttgaatctgttgccgcgcattccggccggtaagcgggtggtgacc
gaaagcggcatcctccagccggacgatgtgcagctcatgcgtcgccacggcgtgcaggcc
tttctggtcggcgaggcctttatgcgcgccgaagagccaggggccgaactggctcgtctg
gtggcctga

DBGET integrated database retrieval system