KEGG   Bordetella avium: BAV3222Help
Entry
BAV3222           CDS       T00695                                 

Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bav  Bordetella avium
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BAV3222
  Carbohydrate metabolism
   00640 Propanoate metabolism
    BAV3222
   00650 Butanoate metabolism
    BAV3222
  Lipid metabolism
   00071 Fatty acid degradation
    BAV3222
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BAV3222
   00310 Lysine degradation
    BAV3222
   00360 Phenylalanine metabolism
    BAV3222
   00380 Tryptophan metabolism
    BAV3222
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BAV3222
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BAV3222
   00281 Geraniol degradation
    BAV3222
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BAV3222
   00627 Aminobenzoate degradation
    BAV3222
   00930 Caprolactam degradation
    BAV3222
Enzymes [BR:bav01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BAV3222
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3500708..3501484)
Genome map
AA seq 258 aa AA seqDB search
MSESLVLVETRGRVGLLTLNRPKALNALNDQVMDELGAALLAFESDAGIGAIVITGSEKA
FAAGADIGAMKDWSYMDVYGSEYITRNWETIKRIRKPIIAAVAGYALGGGCELAMMCDIV
IAADTARFGQPEIKLGVIPGAGGTQRLTRAVGKAKAMDMVLTARMVNAEEAERSGLVSRV
VPADKLLDEALDAATIIASMSLPSVLMAKECVNRAFETPLNEGLLFERRVFHSLFATEDQ
KEGMSAFSEKRKPDFKHR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagtccttagtattggtcgaaacccgtggccgggtgggtctgctgacccttaat
cgccctaaagcgctcaatgccctcaacgatcaggtcatggacgaactcggcgctgcgctg
ctggctttcgagagcgacgccggcattggcgccatcgtgatcacgggcagcgagaaagca
tttgccgcaggcgcggatatcggcgccatgaaagactggtcgtatatggatgtgtacggc
agcgagtacatcacccgtaactgggaaaccatcaagcgcatccgcaagcccatcatcgcc
gccgtggccggctacgcgctgggcggcggttgcgagctggccatgatgtgcgacatcgtg
attgcagccgacaccgcgcgctttggccagcccgaaatcaagctgggcgtcattccgggg
gccggcggcacgcagcgtctcacgcgcgcggtggggaaagccaaggccatggacatggtg
ctgacggcccgcatggtgaacgccgaggaggccgagcgctcgggtctggtgtcgcgcgtg
gtgccggccgacaagctgctcgacgaggcgctggacgccgcgaccatcatcgcttctatg
tcgctgccctcggtcctgatggccaaagagtgcgtcaaccgggctttcgagaccccgctg
aacgaggggctgttgtttgaacgccgcgttttccattcgctctttgcgaccgaagatcag
aaagagggcatgagcgctttctcggaaaagcgtaaaccggacttcaagcatcgctga

DBGET integrated database retrieval system