KEGG   Bordetella avium: BAV3312Help
Entry
BAV3312           CDS       T00695                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bav  Bordetella avium
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BAV3312 (murA)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    BAV3312 (murA)
Enzymes [BR:bav01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     BAV3312 (murA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3601666..3602931
Genome map
AA seq 421 aa AA seqDB search
MDKLRITGGARLHGEVVISGAKNSALPILCASLLTADPVRLSNVPQLNDTRTMLRLLGQM
GVKAESAQTSVNLQADQVHSLEAPYELVKTMRASILVLGPLLARFGEARVSLPGGCTIGQ
RPVDQHIKGLEALGAQITMEHGFVVARAKRLKGASVRTDMVTVTGTENLLMAATLAEGQT
ILENAAREPEVIDLAELLIKMGARIQGHGTDRIVIDGVERLHGADHTVISDRIEAGTFLC
AVGATGGDITLRNTDAAIMGATLDKLTEAGLHIESGPGWIRGVMNGRPKPVGIRTHEYPG
FATDMQAQLMALNTIADGTAIVVENIFENRFMHVQELCRLGADIDIDGHTAVVRGVARLS
GATVMATDLRASASLVIAGLAAEGDTLIDRIYHLDRGYDRMEIKLRNLGARIERVTGKED
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggacaagctgcgcatcaccggcggcgcccggttgcatggcgaggtcgtgatttccggc
gccaagaactcggcgctgcccattttgtgcgccagcctgctcaccgccgatcccgtccgc
ctgagcaatgtgccccagctcaacgacacgcgcaccatgttgcgcctgttgggtcagatg
ggcgtgaaagcggaaagcgcgcaaacctcggtcaacctccaggctgatcaggtccacagc
ctggaagctccctatgagttggtcaagaccatgcgcgcctctatcctggtgctgggtccg
ctgctcgcccgcttcggcgaggcgcgcgtgagcctgccgggaggctgcaccatcggtcaa
cggccggtggatcagcacatcaaggggctggaagccctcggcgcgcagatcacgatggaa
cacggctttgtcgtggcgcgcgccaaacgcctgaaaggcgcatcggtgcgcaccgacatg
gtgacggtcacggggacggaaaatctgctgatggcggcgacgctggccgaaggccaaacg
attctggaaaacgccgcgcgcgaacccgaggtcatcgatctggccgaactgctcatcaag
atgggcgcccggattcaaggccacggcaccgaccgcatcgtgatcgacggcgtcgaacgt
ttgcacggcgccgaccataccgtcatctccgaccgcatcgaagcgggtacgtttctatgc
gccgtcggtgcgacaggcggggatatcacgctgcgcaacaccgacgcggccatcatgggc
gccacgctggacaagctcaccgaggccggactgcatatcgaaagcggtccgggctggatt
cgtggcgtcatgaacggccgccccaagccggttggcatacgcacccatgaataccccggc
ttcgccaccgatatgcaggcccagctgatggctttgaacacgatcgccgatggcaccgcc
atcgtggtcgaaaatatctttgaaaaccgcttcatgcacgtgcaggaactatgccgactg
ggcgcggacatcgacatcgacggccacacggccgtggtgcggggtgtcgcccggctctcc
ggcgccactgtcatggctaccgacctgcgtgcgtcggccagcctggtgatcgccggcctg
gccgctgaaggggacacgctgatcgaccgcatttatcatctggatcgcggctacgatcgc
atggaaatcaaactgcgcaatctcggtgcgcgcatcgagcgcgtcaccggcaaggaagat
gaatga

DBGET integrated database retrieval system