KEGG   Bordetella avium: BAV3314Help
Entry
BAV3314           CDS       T00695                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bav  Bordetella avium
Pathway
bav00340  Histidine metabolism
bav01100  Metabolic pathways
bav01110  Biosynthesis of secondary metabolites
bav01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bav00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    BAV3314 (hisD)
Enzymes [BR:bav01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     BAV3314 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CAJ50924
UniProt: Q2KTT6
Position
3603621..3604928
Genome map
AA seq 435 aa AA seqDB search
MALINRLDSRDAGFQSDLSRLLAFEASQDESIDRAAAGILADVRTRGDTALLEYTQRFDR
MAVDTAAALEIPKTEWQAALNSLPAAQRQALEAAAGRVRAYHEHQRAETWTYTDAEGTML
GQQVTPLDRVGLYVPGGKAAYPSSVLMNAIPAKVAGVPELIMVTPTPDGQRNPIVLAAAA
IGGVDRVFAIGGAQAVGALAYGTATVPAVDKIVGPGNAYVAAAKRRMFGVVGIDMIAGPS
EILIICDGKTPADWIAMDLFSQAEHDELAQSILLCPDAAFIDEVEAAIERLLPTMPRADI
LRTSLANRGALIQVRDLDEACAIANTIAPEHLEISTEQPEIWTARIRHAGAIFMGRYSSE
SLGDYCAGPNHVLPTSRTARFSSPLGVYDFQKRSSLIQVSREGAQTLGRIAAELALGEGL
QAHAASAQYRLDERS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggctctgatcaaccgactcgattcccgcgatgcgggcttccaatccgacctgtcccgc
ttgctggccttcgaagcctcgcaggatgaatccatcgaccgcgctgcggcgggcattctg
gctgatgtgcgcacgcgcggtgacaccgctttgctcgagtacacccagcgttttgaccgc
atggccgtcgataccgccgccgcgctcgaaatccccaagactgaatggcaggctgcgctg
aacagcctgcctgccgcgcagcgccaggccctcgaagcggccgccggccgcgtgcgcgcc
taccacgagcatcagcgcgccgaaacctggacctacaccgacgccgagggcactatgttg
ggccagcaggtcacgccgctggaccgcgtgggcctctatgtgccgggcggcaaagcggcc
tatccgtcttccgtattgatgaacgccatcccggccaaggtggctggcgtgcccgaactc
atcatggtgacacccacgcctgacggccagcgcaatcccatcgtgctggccgctgcggct
atcggcggcgtggaccgcgtattcgccatcggcggcgctcaagccgtcggtgcgctggcc
tatggcacggcaaccgtcccggcggtggacaaaatcgtcggccccggcaacgcctacgtc
gcagcggccaagcggcgcatgtttggcgtggtcggcatcgacatgatcgccggccccagc
gaaatcctgatcatctgcgatggcaagacacccgccgactggatcgcgatggacctgttt
tcccaagccgaacacgacgagctggcgcagtctatcttgctgtgtccggacgcggccttc
atcgacgaagtcgaggccgcgatcgagcggctgctgcccaccatgccgcgcgccgacatc
ctgcgcaccagcctggccaaccgtggcgcgctgatccaggtgcgcgatctggatgaagcc
tgcgccatcgccaacaccatcgcccccgagcatctggaaatctccaccgagcagcctgaa
atctggacagcccgcatccgtcatgccggggccatcttcatgggacgctacagttcggaa
tcgctgggcgattactgcgcgggtcccaaccatgtgttgccgacctcgcgcacggcgcgc
ttttcctcgccgctcggcgtgtatgacttccagaagcgctccagcctcatccaggtatcg
cgcgaaggcgctcagacactgggccgtatcgccgccgaactggcgctgggcgaaggcttg
caggcccatgcggccagcgcgcaataccgcctcgacgaacgctcatga

DBGET integrated database retrieval system