KEGG   Buchnera aphidicola JF98: CWU_00580Help
Entry
CWU_00580         CDS       T01826                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
baw  Buchnera aphidicola JF98
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:baw01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:baw00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
98972..100099
Genome map
AA seq 375 aa AA seqDB search
MTCSITELAKKLISIPSVSPKDLGCQDIIIKRLCAIGFDIKRVNVNDTKNFWAFRGTGKT
LTFAGHTDVVPIGQDKDWQTDPFQPVIRSGYLFGRGSADMKGALAAMITAAERFVNKFPN
HKGRLSFLITSDEESSAVDGTIKVVEYLMSKRDMIDYCIVGEPSSTNIVGDVIKNGRRGS
ITANITIHGIQGHIAYPDLADNPIHKGLPVILKILSIKLDSGNDFFLPSSINIANIHAGN
GFNNVIPGSLFVQFNIRFSSEVSEKHIQSQIVNILNSNDINYSIEWLFSGKPFITKKGLL
IDTVIQSIFYFNKKKPILSTSGGTSDGRFIALMGSEVVELGLVNNTIHKVNECVKISDLK
LLSCMYEDIMKNLLS
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacttgttctattactgaattagcaaaaaaactaatttctattccttctgttagtcca
aaagatttaggttgtcaagatattataataaaacgtttatgtgcaataggatttgacatt
aaaagagtaaatgttaatgatacaaaaaatttttgggcttttagaggtacaggtaaaaca
ttaacatttgcaggacatacagatgtagttccaataggtcaagataaagattggcaaact
gatccttttcaaccagtcatacgaagtggatatttatttggcagaggttctgctgatatg
aagggtgctttagcagcaatgattactgcggctgaaagatttgtaaataagtttccaaat
cataaaggacgtttgtcttttcttattacttcagacgaagagtctagtgcagttgatgga
acaattaaagtagtagaatatttaatgtctaaaagggatatgattgattattgtatagta
ggagaaccctctagtactaatatagtgggtgatgttataaaaaatggtcgacgtggttca
attacagctaatataactattcatggaatacaggggcatattgcatatcctgatttagca
gataatccaatacataaagggttacctgttattttaaaaatattgtctataaaattagat
tctggaaatgacttttttttacctagcagcataaatattgcaaatattcatgcaggaaat
ggatttaataatgtgattccaggatctctatttgttcaatttaatattagatttagttcc
gaagtttctgaaaaacacattcaatctcaaatagtaaatatattaaattcaaatgatatt
aattattctatagaatggttattttcaggaaaaccatttatcactaaaaaaggtttattg
atagacacagtgatacaatctattttttattttaacaaaaaaaagcctattttatctact
tctggtggcacttctgacggtcgatttattgctttaatgggttctgaagtagtagagtta
ggattagtcaataatacaattcataaagttaatgaatgtgtcaaaatatctgatttaaaa
ttattaagctgtatgtatgaagatattatgaaaaatttattatcttaa

DBGET integrated database retrieval system