KEGG   Buchnera aphidicola JF98 (Acyrthosiphon pisum): CWU_01240Help
Entry
CWU_01240         CDS       T01826                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
baw  Buchnera aphidicola JF98 (Acyrthosiphon pisum)
Pathway
baw00260  Glycine, serine and threonine metabolism
baw01100  Metabolic pathways
baw01110  Biosynthesis of secondary metabolites
baw01120  Microbial metabolism in diverse environments
baw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CWU_01240
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CWU_01240
Enzymes [BR:baw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CWU_01240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N SAGA-Tad1 PRMT5_C
Motif
Other DBs
NCBI-ProteinID: ADP67718
Position
complement(207050..208339)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKNHNEQVNFEAAVKLGLGQQQGLFFPVELPTITPIELSKILKMDFITRSTEILS
KFICHEISKEELYKHVKQAFSFKHPLKIKITKDIHCFELFHGPTLAFKDFGARFMAQMIL
LLNKKNESVTILTATSGDTGAAVANAFYGMKNVRVIILYPKGKISELQEKLFCTLGRNIK
TISINGSFDDCQKLVKEAFNDKKLKESIGLNSANSINISRLLAQICYYFEAFSLISEEQR
KNLVIAVPCGNFGNLTAGLLSKSLGLPIKSFIACTNANDTVPRFLNNGTWNPKKTVSTIS
NAMDISQPNNWTRIEELFYRKKWDLKKLRFGSVSDHTTEETLKELFKLGYVSEPHAAIAY
RLLRDQLKENEFGLFLGTAHPAKFKNTVEKILKNKISLPSELQNRIDLPLLSHNINPVFS
KLKTFLLEK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttacaatttaaaaaaccataacgaacaagtaaattttgaagcagccgtaaaa
ttaggattaggtcagcaacaagggttgtttttccctgtagaattacctactattactcct
attgaattatcaaaaatattaaaaatggattttattactcgcagtactgaaatactttct
aaattcatttgtcatgaaatatctaaagaagaactatataaacatgttaaacaagcattt
tcatttaaacatccattaaaaataaaaattacaaaagatatacattgcttcgaactgttt
cacggtccaacattggcgtttaaagattttggagctcgttttatggctcaaatgatatta
ttactaaataaaaaaaatgaatcagttactattttaactgcaacatcaggtgatacaggt
gcagcggtagcaaatgcattctatggaatgaaaaatgtgcgagtaattattttatatcct
aaaggcaagatcagtgaattacaagagaaattattttgtactttaggtagaaatataaaa
actatatcaattaatggtagttttgacgattgtcaaaaattagtaaaagaagcttttaac
gataaaaaactgaaagaatcaataggattaaattcagctaattcaattaatataagtaga
ttattagcacaaatctgttattattttgaagctttctctttaatttcagaagaacaaaga
aaaaatttagtaatagcagttccatgcggtaattttggaaatttaacagctggattatta
tctaaatctcttggtttgccaatcaaatcatttatagcatgtacgaatgcgaatgatacc
gtaccaagattccttaataatggcacgtggaatcctaaaaaaactgtatctacaatttct
aatgctatggatatcagtcaacctaataattggactcgaattgaagaattattttatcga
aaaaaatgggatttaaaaaaacttaggtttggaagtgtatcggatcatactacagaagaa
acattaaaagaactatttaaattaggttatgtttctgaacctcatgcagcaatagcatat
agattgttgcgagatcaattaaaagaaaatgaatttggcttatttttaggcaccgctcat
ccggctaaatttaaaaatactgtagaaaaaatattaaaaaataaaatttcactgccttct
gaactacaaaatagaattgatttaccattattatctcataatattaaccctgtttttagt
aaattaaaaacgtttttattagaaaaataa

DBGET integrated database retrieval system