KEGG   Buchnera aphidicola JF98 (Acyrthosiphon pisum): CWU_01320Help
Entry
CWU_01320         CDS       T01826                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
baw  Buchnera aphidicola JF98 (Acyrthosiphon pisum)
Pathway
baw00010  Glycolysis / Gluconeogenesis
baw00020  Citrate cycle (TCA cycle)
baw00620  Pyruvate metabolism
baw01100  Metabolic pathways
baw01110  Biosynthesis of secondary metabolites
baw01120  Microbial metabolism in diverse environments
baw01130  Biosynthesis of antibiotics
baw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:baw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWU_01320
   00020 Citrate cycle (TCA cycle)
    CWU_01320
   00620 Pyruvate metabolism
    CWU_01320
Enzymes [BR:baw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CWU_01320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: ADP67728
Position
226549..227757
Genome map
AA seq 402 aa AA seqDB search
MDIEVKMPDIGLEEVEIIEILVSINEKIAPEQGLITVEGDKTSMEIPSPISGIVKHIFIK
IGEKIKTDALIMRCEVENIDFHVKKKEEICLDNNVLNKVEKNFKKDIFFHATPLIRRLAR
NLNINLYDVVGTGPKNRILKEDLDLYQSNIKENLIEEKNKINFGDSKKSKTKELELSDIQ
KNIGNNLHRNWMNIPHVTQFDEVDITILEKFRQKYNNEKRNQKKTNENITILVFIIKVVA
HALEKFPIFNSSLNINNKKIILKKYINIGFAIDVNNDLFVPVLKDVNKKNIKQLSSELIL
LSEKARTRKLNIEDMTGGCFTISNLGGIGGSWFSPIINSPEVAILGISKSQIKPSWNGKE
FIPSLMLPLSLSYDHRVINGAYAARFITFISRVLSDMHFLIM
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtggatatagaagtcaaaatgcctgatattggtttagaagaagtagaaataattgaaata
ttagtaagtattaatgaaaaaatagcaccagaacaaggattaataactgtggaaggagat
aaaacttctatggaaataccttcacctatatcaggtattgtaaagcatatcttcattaaa
attggcgaaaaaattaaaactgatgctcttatcatgagatgtgaagtggagaatattgat
tttcatgtaaagaaaaaagaagaaatttgtttagataataatgttttaaataaggttgaa
aaaaatttcaaaaaagatattttttttcatgcaactccattaataagacgtttagctcga
aatttaaatataaatttatacgatgttgttggtaccggacctaaaaataggattttaaaa
gaagatttagatctatatcaaagtaatattaaagagaatcttatagaagaaaaaaataaa
attaattttggtgattctaagaaatcaaaaacaaaagaattagaattaagtgatatccag
aaaaatattggtaataatttacatcggaattggatgaatatacctcatgttacacaattt
gatgaagttgatattactatattagaaaagtttcgtcaaaaatataataacgaaaagaga
aatcaaaaaaaaacaaatgaaaatattacaattttagtttttataataaaagtagttgca
catgcattagaaaaattccctatttttaacagttcactaaatattaataataaaaaaatt
attttaaaaaaatatattaatatcggttttgcaatagatgtaaataacgatttatttgtt
cctgttttaaaagacgtcaataaaaaaaatattaaacaattatcttctgaattaatattg
ctatcagaaaaagcacgaacaagaaaattaaatattgaagatatgacaggaggctgtttt
acaatatctaatttaggaggtattggaggaagctggttttcaccaattatcaattcaccg
gaagtagcaattcttggtatttcaaaatctcagataaaaccgtcatggaatggaaaagaa
tttattccttctttaatgttaccattatctttatcttatgatcatcgtgtaataaatggt
gcttatgcagcgcgttttattacatttattagtagagttttatcagatatgcatttttta
attatgtag

DBGET integrated database retrieval system