KEGG   Buchnera aphidicola JF98: CWU_01320Help
Entry
CWU_01320         CDS       T01826                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
baw  Buchnera aphidicola JF98
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:baw01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:baw00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:baw00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:baw00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
226549..227757
Genome map
AA seq 402 aa AA seqDB search
MDIEVKMPDIGLEEVEIIEILVSINEKIAPEQGLITVEGDKTSMEIPSPISGIVKHIFIK
IGEKIKTDALIMRCEVENIDFHVKKKEEICLDNNVLNKVEKNFKKDIFFHATPLIRRLAR
NLNINLYDVVGTGPKNRILKEDLDLYQSNIKENLIEEKNKINFGDSKKSKTKELELSDIQ
KNIGNNLHRNWMNIPHVTQFDEVDITILEKFRQKYNNEKRNQKKTNENITILVFIIKVVA
HALEKFPIFNSSLNINNKKIILKKYINIGFAIDVNNDLFVPVLKDVNKKNIKQLSSELIL
LSEKARTRKLNIEDMTGGCFTISNLGGIGGSWFSPIINSPEVAILGISKSQIKPSWNGKE
FIPSLMLPLSLSYDHRVINGAYAARFITFISRVLSDMHFLIM
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtggatatagaagtcaaaatgcctgatattggtttagaagaagtagaaataattgaaata
ttagtaagtattaatgaaaaaatagcaccagaacaaggattaataactgtggaaggagat
aaaacttctatggaaataccttcacctatatcaggtattgtaaagcatatcttcattaaa
attggcgaaaaaattaaaactgatgctcttatcatgagatgtgaagtggagaatattgat
tttcatgtaaagaaaaaagaagaaatttgtttagataataatgttttaaataaggttgaa
aaaaatttcaaaaaagatattttttttcatgcaactccattaataagacgtttagctcga
aatttaaatataaatttatacgatgttgttggtaccggacctaaaaataggattttaaaa
gaagatttagatctatatcaaagtaatattaaagagaatcttatagaagaaaaaaataaa
attaattttggtgattctaagaaatcaaaaacaaaagaattagaattaagtgatatccag
aaaaatattggtaataatttacatcggaattggatgaatatacctcatgttacacaattt
gatgaagttgatattactatattagaaaagtttcgtcaaaaatataataacgaaaagaga
aatcaaaaaaaaacaaatgaaaatattacaattttagtttttataataaaagtagttgca
catgcattagaaaaattccctatttttaacagttcactaaatattaataataaaaaaatt
attttaaaaaaatatattaatatcggttttgcaatagatgtaaataacgatttatttgtt
cctgttttaaaagacgtcaataaaaaaaatattaaacaattatcttctgaattaatattg
ctatcagaaaaagcacgaacaagaaaattaaatattgaagatatgacaggaggctgtttt
acaatatctaatttaggaggtattggaggaagctggttttcaccaattatcaattcaccg
gaagtagcaattcttggtatttcaaaatctcagataaaaccgtcatggaatggaaaagaa
tttattccttctttaatgttaccattatctttatcttatgatcatcgtgtaataaatggt
gcttatgcagcgcgttttattacatttattagtagagttttatcagatatgcatttttta
attatgtag

DBGET integrated database retrieval system