KEGG   Buchnera aphidicola JF98 (Acyrthosiphon pisum): CWU_01320Help
Entry
CWU_01320         CDS       T01826                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
baw  Buchnera aphidicola JF98 (Acyrthosiphon pisum)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:baw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CWU_01320
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWU_01320
   00020 Citrate cycle (TCA cycle)
    CWU_01320
   00620 Pyruvate metabolism
    CWU_01320
Enzymes [BR:baw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CWU_01320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
226549..227757
Genome map
AA seq 402 aa AA seqDB search
MDIEVKMPDIGLEEVEIIEILVSINEKIAPEQGLITVEGDKTSMEIPSPISGIVKHIFIK
IGEKIKTDALIMRCEVENIDFHVKKKEEICLDNNVLNKVEKNFKKDIFFHATPLIRRLAR
NLNINLYDVVGTGPKNRILKEDLDLYQSNIKENLIEEKNKINFGDSKKSKTKELELSDIQ
KNIGNNLHRNWMNIPHVTQFDEVDITILEKFRQKYNNEKRNQKKTNENITILVFIIKVVA
HALEKFPIFNSSLNINNKKIILKKYINIGFAIDVNNDLFVPVLKDVNKKNIKQLSSELIL
LSEKARTRKLNIEDMTGGCFTISNLGGIGGSWFSPIINSPEVAILGISKSQIKPSWNGKE
FIPSLMLPLSLSYDHRVINGAYAARFITFISRVLSDMHFLIM
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
gtggatatagaagtcaaaatgcctgatattggtttagaagaagtagaaataattgaaata
ttagtaagtattaatgaaaaaatagcaccagaacaaggattaataactgtggaaggagat
aaaacttctatggaaataccttcacctatatcaggtattgtaaagcatatcttcattaaa
attggcgaaaaaattaaaactgatgctcttatcatgagatgtgaagtggagaatattgat
tttcatgtaaagaaaaaagaagaaatttgtttagataataatgttttaaataaggttgaa
aaaaatttcaaaaaagatattttttttcatgcaactccattaataagacgtttagctcga
aatttaaatataaatttatacgatgttgttggtaccggacctaaaaataggattttaaaa
gaagatttagatctatatcaaagtaatattaaagagaatcttatagaagaaaaaaataaa
attaattttggtgattctaagaaatcaaaaacaaaagaattagaattaagtgatatccag
aaaaatattggtaataatttacatcggaattggatgaatatacctcatgttacacaattt
gatgaagttgatattactatattagaaaagtttcgtcaaaaatataataacgaaaagaga
aatcaaaaaaaaacaaatgaaaatattacaattttagtttttataataaaagtagttgca
catgcattagaaaaattccctatttttaacagttcactaaatattaataataaaaaaatt
attttaaaaaaatatattaatatcggttttgcaatagatgtaaataacgatttatttgtt
cctgttttaaaagacgtcaataaaaaaaatattaaacaattatcttctgaattaatattg
ctatcagaaaaagcacgaacaagaaaattaaatattgaagatatgacaggaggctgtttt
acaatatctaatttaggaggtattggaggaagctggttttcaccaattatcaattcaccg
gaagtagcaattcttggtatttcaaaatctcagataaaaccgtcatggaatggaaaagaa
tttattccttctttaatgttaccattatctttatcttatgatcatcgtgtaataaatggt
gcttatgcagcgcgttttattacatttattagtagagttttatcagatatgcatttttta
attatgtag

DBGET integrated database retrieval system