KEGG   Buchnera aphidicola JF98 (Acyrthosiphon pisum): CWU_01820Help
Entry
CWU_01820         CDS       T01826                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
baw  Buchnera aphidicola JF98 (Acyrthosiphon pisum)
Pathway
baw00260  Glycine, serine and threonine metabolism
baw00400  Phenylalanine, tyrosine and tryptophan biosynthesis
baw01100  Metabolic pathways
baw01110  Biosynthesis of secondary metabolites
baw01130  Biosynthesis of antibiotics
baw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baw00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CWU_01820
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CWU_01820
Enzymes [BR:baw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CWU_01820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADP67780
Position
complement(303913..305124)
Genome map
AA seq 403 aa AA seqDB search
MTLLNPYFGEFGGMYVPQILMPALFELEENFVSAQKDAEFQKKFFYLLQNYAGRPTPLTL
CKNLTKGTKTKIYLKREDLLHGGAHKTNQVLGQAMLAIRMKKKEIIAETGAGQHGVASAI
ACALFNLKCRIYMGIKDIKRQNTNVFRMKLMGAEVISVKNGSGTLKDACNEALRDWSSSY
KKSHYMIGTAAGPHPYPTIVREFQKMIGEETKKQILEKENKLPDSIIACIGGGSNAIGIF
SNFINDKVNLIGVEPAGYGIHTGKHGAPLKHGRTGIYFGMKSHLMQNKQGQIQESWSISA
GLDFPSVGPEHAWLNSINRAKYVSITDEEAISAFQVLSRKEGIIPALESSHALAYALKLM
KKDPKKEQILIVNLSGRGDKDIFTVHDVLKKKESNHESISGNI
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgactttactaaatccttattttggtgagtttggcggtatgtacgttccacaaatatta
atgccagctttatttgaattggaagaaaattttgtttccgcgcaaaaagatgctgaattt
caaaaaaaatttttttatttattacaaaactatgctggcagacctactccattaactcta
tgtaaaaatttaaccaaaggaacaaaaacaaaaatttatcttaaaagagaagatttacta
catggtggagcacataaaactaatcaagtattaggtcaagctatgttagcaattagaatg
aaaaagaaagaaattattgctgaaacaggtgctggacaacatggtgtagcttctgcaatt
gcttgtgcactatttaatttaaaatgtagaatttacatgggaattaaagatattaaaaga
caaaacacaaatgtgtttcgtatgaaattaatgggtgcagaagtcatctcagttaaaaac
ggttctggaacactaaaagacgcatgtaatgaagctttacgcgattggtctagtagttat
aaaaaatctcattatatgattggtactgcagctggaccacatccctatcccactattgtt
cgtgaatttcaaaagatgattggggaagaaacaaaaaaacaaattttagaaaaagaaaac
aaacttcctgattcaattattgcatgtattggcggtggatctaatgctattggtatattt
tcaaattttattaatgataaagttaatttaatcggagtagaaccggctggttatgggata
cacacaggaaaacatggggcaccattaaaacatggtagaaccggtatttattttggtatg
aaatcacatttgatgcaaaataaacagggtcagattcaagaatcttggtcaatttcagca
ggattagattttccatctgttggtcctgaacatgcttggttgaatagtattaaccgtgcg
aaatatgtctctattactgatgaggaagcaataagtgcatttcaggttttatctcgaaaa
gaaggcattattcctgctttagaatcttctcatgcattagcatatgcattaaaattaatg
aaaaaagatcctaaaaaagaacaaattttaattgttaatctttctggtcgtggagataaa
gatatttttacagtacatgatgttttaaaaaagaaggagagtaatcatgaatcgatatca
ggaaacatttaa

DBGET integrated database retrieval system