KEGG   Buchnera aphidicola JF98 (Acyrthosiphon pisum): CWU_01960Help
Entry
CWU_01960         CDS       T01826                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
baw  Buchnera aphidicola JF98 (Acyrthosiphon pisum)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:baw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CWU_01960
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CWU_01960
  Amino acid metabolism
   00310 Lysine degradation
    CWU_01960
Enzymes [BR:baw01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CWU_01960
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
337004..338266
Genome map
AA seq 420 aa AA seqDB search
MKKINILVPDLPESISDATVVKWHKKIGDTVHCDDNIVDLETDKVMLEVSSPCDGILQSI
LEKEGKVVISQQTLGEINKSTVVDNHLSNNHIIEKEDNLLKKEEKYITTEEKKEIEYLLK
DNHKHLTPSMRRSVKIHNINNGFLNQVIETSKKTNFENIIKEEKKESNQILFNHNIFNVN
ENNKNNNNKVTNRVKMTRLRQRIAERLLDSKNNTAMLTTFHEVNMKPIILLRKKYGEDFE
KKHNVRIGFMSFFVKAVIQALKNFPEINAYIDQTDIVFYKNFDISIAISTPRGLITPVIR
NADTMTMAEIEKKIKDFSMKGLQNKINIKELMGGNFTITNGGVFGSLMSTPIINPPQTAI
LGMHVIQERPVVVNGQIKILPMMYLALSYDHRLIDGKESVGFLINIKNILEDFNRIAIDV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataaatattcttgttccagatttaccagaatctattagtgatgcaacagtt
gtaaaatggcacaaaaaaataggagatacagttcactgtgatgataatatagttgatctt
gaaacagataaagtcatgttagaagtatcttctccatgtgatggaatattacaatcaatt
ttagaaaaagaagggaaagtagttatatctcaacaaacacttggtgaaataaacaaatct
actgtggttgataaccatctttccaataatcatattattgaaaaagaagataatttatta
aaaaaagaagaaaaatatataactacggaagaaaaaaaagaaatagaatatttattaaaa
gataatcacaaacatctgactccatctatgagacgatcagtcaaaatacataatattaat
aatggttttttaaatcaagtgatcgaaacaagtaaaaaaactaattttgaaaatattata
aaagaagaaaaaaaagaatcgaatcaaattttattcaatcataatatatttaatgttaat
gaaaataataaaaataataataataaggttacgaatcgagtaaaaatgactcgattacga
caaagaattgcagaacgattactagatagcaaaaataatacagctatgctaactactttt
catgaagtaaatatgaaaccaatcatacttttacgtaaaaagtatggtgaagattttgaa
aaaaaacataatgttagaattggatttatgtctttttttgtaaaagcagttattcaagca
ttaaaaaattttccagaaattaatgcttacatagatcaaacagatatagttttttataaa
aattttgacatcagtattgctatttcgacgccaagagggttgattactccggtaataaga
aatgctgatacaatgacaatggcagaaattgaaaaaaaaataaaggatttttctatgaaa
ggattgcaaaataaaatcaatataaaagaattaatgggtggcaatttcaccattactaat
ggtggtgtttttggttccttaatgtcgactcctattattaaccctcctcaaacagccata
ttaggtatgcatgtaattcaagaacgtccagtagttgtaaatggacaaattaaaattctt
ccaatgatgtatttagcattatcttatgatcatcgtttaatagatggaaaagaatctgtc
ggttttttaatcaatataaaaaatatattagaagattttaatcgtattgcaattgatgtg
tag

DBGET integrated database retrieval system