KEGG   Buchnera aphidicola JF98: CWU_01960Help
Entry
CWU_01960         CDS       T01826                                 

Definition
2-oxoglutarate dehydrogenase E2 component
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
baw  Buchnera aphidicola JF98
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:baw01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:baw00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:baw00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
337004..338266
Genome map
AA seq 420 aa AA seqDB search
MKKINILVPDLPESISDATVVKWHKKIGDTVHCDDNIVDLETDKVMLEVSSPCDGILQSI
LEKEGKVVISQQTLGEINKSTVVDNHLSNNHIIEKEDNLLKKEEKYITTEEKKEIEYLLK
DNHKHLTPSMRRSVKIHNINNGFLNQVIETSKKTNFENIIKEEKKESNQILFNHNIFNVN
ENNKNNNNKVTNRVKMTRLRQRIAERLLDSKNNTAMLTTFHEVNMKPIILLRKKYGEDFE
KKHNVRIGFMSFFVKAVIQALKNFPEINAYIDQTDIVFYKNFDISIAISTPRGLITPVIR
NADTMTMAEIEKKIKDFSMKGLQNKINIKELMGGNFTITNGGVFGSLMSTPIINPPQTAI
LGMHVIQERPVVVNGQIKILPMMYLALSYDHRLIDGKESVGFLINIKNILEDFNRIAIDV
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaataaatattcttgttccagatttaccagaatctattagtgatgcaacagtt
gtaaaatggcacaaaaaaataggagatacagttcactgtgatgataatatagttgatctt
gaaacagataaagtcatgttagaagtatcttctccatgtgatggaatattacaatcaatt
ttagaaaaagaagggaaagtagttatatctcaacaaacacttggtgaaataaacaaatct
actgtggttgataaccatctttccaataatcatattattgaaaaagaagataatttatta
aaaaaagaagaaaaatatataactacggaagaaaaaaaagaaatagaatatttattaaaa
gataatcacaaacatctgactccatctatgagacgatcagtcaaaatacataatattaat
aatggttttttaaatcaagtgatcgaaacaagtaaaaaaactaattttgaaaatattata
aaagaagaaaaaaaagaatcgaatcaaattttattcaatcataatatatttaatgttaat
gaaaataataaaaataataataataaggttacgaatcgagtaaaaatgactcgattacga
caaagaattgcagaacgattactagatagcaaaaataatacagctatgctaactactttt
catgaagtaaatatgaaaccaatcatacttttacgtaaaaagtatggtgaagattttgaa
aaaaaacataatgttagaattggatttatgtctttttttgtaaaagcagttattcaagca
ttaaaaaattttccagaaattaatgcttacatagatcaaacagatatagttttttataaa
aattttgacatcagtattgctatttcgacgccaagagggttgattactccggtaataaga
aatgctgatacaatgacaatggcagaaattgaaaaaaaaataaaggatttttctatgaaa
ggattgcaaaataaaatcaatataaaagaattaatgggtggcaatttcaccattactaat
ggtggtgtttttggttccttaatgtcgactcctattattaaccctcctcaaacagccata
ttaggtatgcatgtaattcaagaacgtccagtagttgtaaatggacaaattaaaattctt
ccaatgatgtatttagcattatcttatgatcatcgtttaatagatggaaaagaatctgtc
ggttttttaatcaatataaaaaatatattagaagattttaatcgtattgcaattgatgtg
tag

DBGET integrated database retrieval system