KEGG   Buchnera aphidicola JF98 (Acyrthosiphon pisum): CWU_01965Help
Entry
CWU_01965         CDS       T01826                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
baw  Buchnera aphidicola JF98 (Acyrthosiphon pisum)
Pathway
baw00010  Glycolysis / Gluconeogenesis
baw00260  Glycine, serine and threonine metabolism
baw00680  Methane metabolism
baw01100  Metabolic pathways
baw01110  Biosynthesis of secondary metabolites
baw01120  Microbial metabolism in diverse environments
baw01130  Biosynthesis of antibiotics
baw01200  Carbon metabolism
baw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWU_01965 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    CWU_01965 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CWU_01965 (gpmA)
Enzymes [BR:baw01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     CWU_01965 (gpmA)
Membrane trafficking [BR:baw04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    CWU_01965 (gpmA)
Exosome [BR:baw04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   CWU_01965 (gpmA)
  Exosomal proteins of melanoma cells
   CWU_01965 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 MAF_flag10
Motif
Other DBs
NCBI-ProteinID: ADP67803
Position
338365..339060
Genome map
AA seq 231 aa AA seqDB search
MKINQVVLIRHGQSEWNTLNKFTGWHDAELDKKGKDEAKFAAILLKKEKFFFDCAHTSLL
KRAIHTLQYILDELNQTWLSVKKSWRLNERHYGALEGLNKDEVIEKYGQKQVLLWRRSFD
ISPPQINIKDKRFPGNDPRYSHLNIHDIPLGESLEKTAKRVIPYWNKIIYPELKNNKKIL
IVAHGNSLRALIQHLYKIDNKAILDLNIPTAQPIILDFDNEKNPIKWHYLT
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaatcaagtagttttaattagacatggtcaaagcgaatggaatacattaaat
aaatttactggttggcatgatgccgaattagataaaaaaggaaaagatgaagctaaattt
gctgctatcttattaaaaaaagaaaaatttttttttgattgcgcacatacatcattatta
aaaagagcaattcatactttgcaatatattttagatgaattaaaccaaacctggttgtca
gttaaaaaatcctggcgtttaaacgaacgacattatggtgcattagaagggttaaataaa
gatgaagttattgagaaatatggacaaaaacaagttcttctatggagaagaagttttgat
attagtccacctcagattaatataaaagataaacgctttccaggaaacgatccacgctac
tctcatttaaatattcatgacatccctctaggagagagcttagaaaaaactgcaaaacga
gttattccttattggaacaaaattatttatccagaattaaaaaataataaaaaaatactt
attgtagcgcatggaaattctttacgtgccttgatacaacacttatataaaatagacaat
aaagctattttagatttaaatattcctactgcacaacccattatcttagatttcgataat
gaaaaaaatccaattaaatggcactatttaacataa

DBGET integrated database retrieval system