KEGG   Buchnera aphidicola JF98 (Acyrthosiphon pisum): CWU_01990Help
Entry
CWU_01990         CDS       T01826                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
baw  Buchnera aphidicola JF98 (Acyrthosiphon pisum)
Pathway
baw00010  Glycolysis / Gluconeogenesis
baw00051  Fructose and mannose metabolism
baw00562  Inositol phosphate metabolism
baw01100  Metabolic pathways
baw01110  Biosynthesis of secondary metabolites
baw01120  Microbial metabolism in diverse environments
baw01130  Biosynthesis of antibiotics
baw01200  Carbon metabolism
baw01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWU_01990 (tpiA)
   00051 Fructose and mannose metabolism
    CWU_01990 (tpiA)
   00562 Inositol phosphate metabolism
    CWU_01990 (tpiA)
Enzymes [BR:baw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CWU_01990 (tpiA)
Exosome [BR:baw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CWU_01990 (tpiA)
  Exosomal proteins of bladder cancer cells
   CWU_01990 (tpiA)
  Exosomal proteins of melanoma cells
   CWU_01990 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADP67804
Position
complement(341073..341840)
Genome map
AA seq 255 aa AA seqDB search
MKKFFITANWKLNGNIKMISSFFKYLKLYSSSYLEKNTVIIAPPTIYLERVCKNISNMNI
FLGSQNVDINLNGAFTGETSILMLRDIGVKYVIIGHSERRFLHHETDDIIAKKFHLIKKS
NLTPILCVGETEIEKKHNQTEQVIQRQLNLILKNLGTSAFKNIIIAYEPIWAIGTGVSAD
PEHVQLIHVFIKNYILKYSSINRNDIIIQYGGSINHTNVKKFIEQPDINGLLIGNSSLSA
KEFLEIIKIAHEHYS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattcttcattacagctaactggaaattaaatggaaatataaaaatgatttct
agttttttcaaatatttaaaattatattcatcaagttatttagaaaaaaacactgttatt
attgctcctccaactatatatttagaacgagtatgtaaaaatataagcaatatgaacatt
tttcttggttcgcaaaacgtagatattaatttaaacggagcatttaccggtgaaacttct
attttgatgctgcgagatataggagtaaaatatgtgattatagggcattccgaaagacgt
tttttacatcatgaaactgatgatatcattgcaaaaaaatttcatttaattaaaaaatca
aatttaacacctatattgtgtgtaggtgaaacagaaatagaaaaaaaacataatcaaacc
gagcaggttattcaaagacaattaaatttgatattaaaaaatttaggcacatcagcattt
aaaaatataataattgcctatgaacctatttgggccatcggaactggtgtatcagcagat
ccagaacatgttcaactaatacatgtatttataaaaaattatattttaaaatatagctca
atcaatagaaatgatataataattcaatacggtggatctattaatcatactaatgtaaaa
aagtttattgaacaaccagacatcaatggtttattaattggaaattcatctttaagtgct
aaagaatttttagaaattataaaaatagcacacgaacactattcataa

DBGET integrated database retrieval system