KEGG   Buchnera aphidicola JF98 (Acyrthosiphon pisum): CWU_01990Help
Entry
CWU_01990         CDS       T01826                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
baw  Buchnera aphidicola JF98 (Acyrthosiphon pisum)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:baw00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CWU_01990 (tpiA)
   01230 Biosynthesis of amino acids
    CWU_01990 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CWU_01990 (tpiA)
   00051 Fructose and mannose metabolism
    CWU_01990 (tpiA)
   00562 Inositol phosphate metabolism
    CWU_01990 (tpiA)
Enzymes [BR:baw01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CWU_01990 (tpiA)
Exosome [BR:baw04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CWU_01990 (tpiA)
  Exosomal proteins of bladder cancer cells
   CWU_01990 (tpiA)
  Exosomal proteins of melanoma cells
   CWU_01990 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(341073..341840)
Genome map
AA seq 255 aa AA seqDB search
MKKFFITANWKLNGNIKMISSFFKYLKLYSSSYLEKNTVIIAPPTIYLERVCKNISNMNI
FLGSQNVDINLNGAFTGETSILMLRDIGVKYVIIGHSERRFLHHETDDIIAKKFHLIKKS
NLTPILCVGETEIEKKHNQTEQVIQRQLNLILKNLGTSAFKNIIIAYEPIWAIGTGVSAD
PEHVQLIHVFIKNYILKYSSINRNDIIIQYGGSINHTNVKKFIEQPDINGLLIGNSSLSA
KEFLEIIKIAHEHYS
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattcttcattacagctaactggaaattaaatggaaatataaaaatgatttct
agttttttcaaatatttaaaattatattcatcaagttatttagaaaaaaacactgttatt
attgctcctccaactatatatttagaacgagtatgtaaaaatataagcaatatgaacatt
tttcttggttcgcaaaacgtagatattaatttaaacggagcatttaccggtgaaacttct
attttgatgctgcgagatataggagtaaaatatgtgattatagggcattccgaaagacgt
tttttacatcatgaaactgatgatatcattgcaaaaaaatttcatttaattaaaaaatca
aatttaacacctatattgtgtgtaggtgaaacagaaatagaaaaaaaacataatcaaacc
gagcaggttattcaaagacaattaaatttgatattaaaaaatttaggcacatcagcattt
aaaaatataataattgcctatgaacctatttgggccatcggaactggtgtatcagcagat
ccagaacatgttcaactaatacatgtatttataaaaaattatattttaaaatatagctca
atcaatagaaatgatataataattcaatacggtggatctattaatcatactaatgtaaaa
aagtttattgaacaaccagacatcaatggtttattaattggaaattcatctttaagtgct
aaagaatttttagaaattataaaaatagcacacgaacactattcataa

DBGET integrated database retrieval system