KEGG   Buchnera aphidicola JF98 (Acyrthosiphon pisum): CWU_02520Help
Entry
CWU_02520         CDS       T01826                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
baw  Buchnera aphidicola JF98 (Acyrthosiphon pisum)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:baw00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CWU_02520
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CWU_02520
Enzymes [BR:baw01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     CWU_02520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
427202..428233
Genome map
AA seq 343 aa AA seqDB search
MEKLYVEGNKILNGHVIISGSKNAALPILFMTILTEGKIKIGNIPNLTDINIALKLLVYL
GVKITGNETLCIDASSINIFCPPYNLINKIRASIWILGPLLARFGKAKIFLPGGCKIGSR
PIDLHLNGLTQLGATINLKNNCIDAYVKGRLQGKYILMEKISVGATITIMSAATLAKGST
IIDNAACEPEIVDIAKFLNTLGADIIGAGSNKICIKGVLKLTGGTHQVIPDRIETGTFLV
AAAASQGHITCHKTEPKHLTNVLMKLTEAGAKIKTGKDWIKLDMRGKRPKSLNICTAPYP
GFPTDMQAQFALLNSISKGIGTITETIFENRFIYTSELIRMGG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattatacgtagaaggaaataaaatattaaatggccatgttatcatttctggt
tctaaaaacgcggctttacctattttatttatgactatattaacagaaggaaaaataaaa
atcggaaatattccgaatttaacagacattaacatagcacttaaattgctagtatattta
ggagtaaaaataacaggaaacgaaacattatgtattgatgctagttcgataaatattttt
tgtcctccatacaatttaatcaataaaatcagagcttctatctggatattaggtcctctt
ttagctcgttttggcaaagctaaaatatttttacctggaggatgtaaaattggcagtaga
cctatagatttacatttaaatggtttaacacaattaggtgcaacaattaacttaaaaaat
aactgtattgatgcttatgttaaaggacgtttacaaggaaaatacattttaatggaaaaa
attagtgttggtgctaccattacaattatgagtgcagccactttagccaaaggctctaca
attattgataacgccgcttgcgaaccagaaattgttgatattgcaaagtttttaaatacc
ttaggagctgatattattggggcaggaagtaataaaatatgtattaaaggcgtcttaaaa
ttaactggtggtacacatcaagtcattcctgatagaattgaaacaggaacatttttagtt
gctgcggcagcctctcaaggtcatattacttgtcataagactgaacctaaacatttaaca
aatgtattgatgaaactaactgaagccggagcaaaaataaaaacaggaaaagattggatt
aaattagacatgagaggtaaaagacctaaatctttaaatatttgcactgctccttatcct
ggatttccaacagatatgcaggctcaatttgctctattaaacagtatttctaaaggcata
ggtactattactgaaaccatatttgaaaaccgttttatttacacctctgaattaattagg
atggggggctaa

DBGET integrated database retrieval system