KEGG   Buchnera aphidicola JF98: CWU_02520Help
Entry
CWU_02520         CDS       T01826                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
baw  Buchnera aphidicola JF98
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:baw00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:baw00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
427202..428233
Genome map
AA seq 343 aa AA seqDB search
MEKLYVEGNKILNGHVIISGSKNAALPILFMTILTEGKIKIGNIPNLTDINIALKLLVYL
GVKITGNETLCIDASSINIFCPPYNLINKIRASIWILGPLLARFGKAKIFLPGGCKIGSR
PIDLHLNGLTQLGATINLKNNCIDAYVKGRLQGKYILMEKISVGATITIMSAATLAKGST
IIDNAACEPEIVDIAKFLNTLGADIIGAGSNKICIKGVLKLTGGTHQVIPDRIETGTFLV
AAAASQGHITCHKTEPKHLTNVLMKLTEAGAKIKTGKDWIKLDMRGKRPKSLNICTAPYP
GFPTDMQAQFALLNSISKGIGTITETIFENRFIYTSELIRMGG
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattatacgtagaaggaaataaaatattaaatggccatgttatcatttctggt
tctaaaaacgcggctttacctattttatttatgactatattaacagaaggaaaaataaaa
atcggaaatattccgaatttaacagacattaacatagcacttaaattgctagtatattta
ggagtaaaaataacaggaaacgaaacattatgtattgatgctagttcgataaatattttt
tgtcctccatacaatttaatcaataaaatcagagcttctatctggatattaggtcctctt
ttagctcgttttggcaaagctaaaatatttttacctggaggatgtaaaattggcagtaga
cctatagatttacatttaaatggtttaacacaattaggtgcaacaattaacttaaaaaat
aactgtattgatgcttatgttaaaggacgtttacaaggaaaatacattttaatggaaaaa
attagtgttggtgctaccattacaattatgagtgcagccactttagccaaaggctctaca
attattgataacgccgcttgcgaaccagaaattgttgatattgcaaagtttttaaatacc
ttaggagctgatattattggggcaggaagtaataaaatatgtattaaaggcgtcttaaaa
ttaactggtggtacacatcaagtcattcctgatagaattgaaacaggaacatttttagtt
gctgcggcagcctctcaaggtcatattacttgtcataagactgaacctaaacatttaaca
aatgtattgatgaaactaactgaagccggagcaaaaataaaaacaggaaaagattggatt
aaattagacatgagaggtaaaagacctaaatctttaaatatttgcactgctccttatcct
ggatttccaacagatatgcaggctcaatttgctctattaaacagtatttctaaaggcata
ggtactattactgaaaccatatttgaaaaccgttttatttacacctctgaattaattagg
atggggggctaa

DBGET integrated database retrieval system