KEGG   Buchnera aphidicola JF98: CWU_02995Help
Entry
CWU_02995         CDS       T01826                                 

Definition
exodeoxyribonuclease V 67 kDa polypeptide
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
baw  Buchnera aphidicola JF98
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:baw03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
501724..503493
Genome map
AA seq 589 aa AA seqDB search
MLILLKKAVKLKIIRPIDFYFSQFIAQKNNIVMLVAACISYESSRGYISLPIKYFEKHYF
FSSSNEVFIKKILTLLEKKINWPVELLKHASIGNGGTSTPLVLHKKKIYLYKMWKSESNI
FNYLYTKNKKNKINQKKCSKILENLFPQKNMSFQKIAVALTLINNITFIIGGPGTGKTTT
ILKIIIALIKSSKKSIKIQLSAPTGKATTHLNEILKNNIFDLYFSEKEKCSLPSTATTIH
QLLGIQKISQKSFFNKSNCLDLDVLIIDEISMVDILMMEKILSSISKNTKLIFIGDHNQL
GPIESGSILRKICYYANDGYSFKSMISIEKLTQYKLCKKINKKTTNFISDNICVLNKNYR
FNKNSGIYTLSNAIFKKKTRIIESLFDNSIKNIFFYETNSSEQYKKMIKNICLNYEDFWE
KIYKKATMKEIIESFQNYQVLCILHDGLFGVNIINKKLEENMYKKNIIKYFYIDGEEWYI
GKPIMIINNNRALNVSNGNIGITNINKNGILQVSFLKENNTINNIPVKILRNYKTAWAIT
VHKSQGSEFMNTALILPNFNSHILNKDTLYTGITRSRKILSIFSDKKIF
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgcttattttattaaaaaaagctgtaaaattgaaaattatacgtccaattgatttttat
ttttctcaatttatcgcacaaaaaaataatattgttatgttagttgctgcttgtataagt
tatgaaagcagtagaggttatatttctctgccaattaaatattttgaaaaacattatttt
ttttctagttcaaatgaagtatttataaaaaaaatattgactcttttagaaaaaaaaata
aattggcccgttgagttattaaaacatgcatctattggtaatggtggtacttctacacct
ttagttttacataaaaaaaaaatatatctctataaaatgtggaaatctgaaagtaatatt
tttaactatttatatacaaaaaataaaaaaaataaaattaatcaaaaaaaatgctcaaaa
atattggaaaatttgtttcctcaaaaaaatatgagttttcagaaaatagcagtagcatta
actttaataaataatataacatttattattggtgggcccggaactggaaaaactactact
atattgaaaataataattgcattaataaaaagttcaaaaaaatcaataaaaattcagtta
tctgcaccgacaggaaaagcgacaacacatttaaatgaaattctaaaaaacaatatcttt
gatctgtatttttctgaaaaagaaaagtgttctctaccatctacagctacaactatacat
caactattgggtattcaaaaaatatcacaaaaaagtttttttaataaaagtaactgctta
gatttagatgttttgattatcgatgaaatctcaatggtagacattttaatgatggaaaaa
atattatcttcaatttcaaaaaataccaagttaatttttataggagatcataatcaatta
ggtccaatagaatcaggttctattctaagaaaaatttgttattacgcaaatgatggatat
agctttaaatctatgattagtattgaaaaacttacacaatataaattgtgtaaaaaaata
aataaaaaaacaacaaactttattagtgataatatatgtgttttaaataaaaactacaga
tttaataaaaattcaggtatttatacgttgtctaatgctatttttaagaaaaaaactagg
atcattgaaagtctatttgataattcgataaaaaacatttttttttatgaaactaactct
tctgaacaatataaaaaaatgattaaaaatatatgtttaaactatgaagatttttgggaa
aaaatatataaaaaagcgacaatgaaagaaataatagaatcttttcaaaattatcaagtt
ttgtgcatattgcatgatggtttatttggtgtgaatattataaataaaaagttagaagaa
aatatgtataaaaaaaatattataaaatatttttatattgatggagaagaatggtatata
gggaaacctattatgattattaataataatcgtgctctcaatgtatcaaatggaaatata
ggtattactaacatcaataaaaatggcattttacaagtatcttttttaaaagaaaacaat
acaattaataatattcctgtaaagatattaagaaattataaaactgcctgggctattact
gttcataaatcacaaggttcagaatttatgaatacagctttaatactacctaatttcaac
tctcatattttaaataaagacactttgtatactggtataacaagatctcgaaaaatatta
agtattttttcagataaaaaaattttttaa

DBGET integrated database retrieval system