KEGG   Buchnera aphidicola JF98: CWU_03820Help
Entry
CWU_03820         CDS       T01826                                 

Definition
uroporphyrinogen-III synthase, putative
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
baw  Buchnera aphidicola JF98
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:baw00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
626411..626824
Genome map
AA seq 137 aa AA seqDB search
MKIINKDKIKNNRIILLQGENGRKLIKRRLEKEGFKICLIECYKRVFKILDTNMEVKKWR
SYKIDTLVVTNSESLHQLKNIISSTNQIQWLFGCRIFVVGKRLFRIAKKLGWNDVIVSKY
ANNDSFIKKIKETNFKN
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaataatcaataaagacaaaataaaaaataatagaataattttattacaaggggaa
aatggacgaaaattaataaaaagaagattagaaaaagaaggatttaaaatttgtctaatt
gaatgttataaaagagtcttcaaaattttagatactaatatggaggtaaaaaaatggcgt
tcatataaaatagatactttagtagtaacaaatagcgaatctttacatcagttaaaaaat
attatttctagtactaatcagattcaatggttattcggatgcaggatttttgttgtcggt
aaaagattgtttcgtatagcaaaaaaattaggatggaatgatgtaatagtttcaaaatat
gctaataatgattcttttatcaaaaaaataaaagaaacgaattttaaaaattaa

DBGET integrated database retrieval system