KEGG   Bacillus anthracis H9401: H9401_0014Help
Entry
H9401_0014        CDS       T02028                                 

Definition
Deoxynucleoside kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
bax  Bacillus anthracis H9401
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bax00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bax00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(22456..23124)
Genome map
AA seq 222 aa AA seqDB search
MNLRQKYDIPNDAVITIAGTVGVGKSTMTTALANALGYRTSFEKVDSNPYLDKFYADFTR
WSFHLQVYFLAERFKEQKRIFEYGGGFVQDRSIYEDTGIFAKMHHEKGTMTETDYETYKG
LFDAMVMTPYFPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINN
FNSCPVLRLNINEYDILKDGDSIEPIIKKIGHFLKQTRKLVK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaggcaaaaatatgatataccaaatgacgcagtaatcactatcgctggaaca
gtaggtgtcggtaaatccactatgacaactgcattagctaacgctttaggatatcgcaca
tcatttgaaaaggtagattctaacccgtatttggacaagttctatgctgatttcacacgc
tggagctttcacttacaagtgtactttttagcagaacgatttaaagaacaaaaaaggatt
tttgaatacggtggtggttttgttcaagatcgctctatctatgaagacactggcattttt
gcaaaaatgcatcacgaaaagggtacaatgacggaaactgattatgaaacatataaaggt
ttatttgacgctatggtcatgactccttacttccctcatccagatttactaatctactta
gaaggttctttcgatgatatcgttgatcgtatccaagaacgtggacgtccgatggaacag
caaacgccaattgagtattggaaagagatgcatgggcgttatgaaaactggattaataac
tttaattcatgccctgtcttacgattaaatattaatgaatacgatattttaaaagatggc
gattccattgaaccaatcattaaaaagatcggccattttttaaaacaaacacgtaaactt
gtaaaataa

DBGET integrated database retrieval system