KEGG   Bacillus anthracis H9401: H9401_0040Help
Entry
H9401_0040        CDS       T02028                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bax  Bacillus anthracis H9401
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H9401_0040
Enzymes [BR:bax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     H9401_0040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
48113..48970
Genome map
AA seq 285 aa AA seqDB search
MKAPAKINLSLDVLGKRQDGYHEVKMIMTTIDLADRLELMELAEDRIEILSHNRYVPDDQ
RNLAYQAAKLLKEKFNVKKGVSITIEKTIPVAAGLAGGSSDAAATLRGLNKLWNLGLTID
QLAELGAEIGSDVSFCVYGGTAIATGRGEQIEHIKTPPSCWVILAKPHIGVSTADVYGNL
KLNRVTHPNVDKMVDVINAGDYKGICDTVGNVLEDVTFAMHPEVARIKAQMKRFGADAVL
MSGSGPTVFGLVHHDSRMHRIYNGLKGFCEQVYAVRLLGERETLE
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagcaccagcaaagattaatctgtcgttagatgtactgggaaaaagacaagacgga
tatcatgaagtgaaaatgattatgacaacaatcgatttagcggatcgtttagaactaatg
gaattagcagaagaccgtattgaaattttatcccataatcggtatgtcccagacgaccaa
agaaatctggcttatcaagcagcgaaattattaaaagagaagtttaatgtgaaaaaaggt
gtatctattactattgaaaaaacgattccagtagcagctggattagcgggtggaagtagt
gatgcagcagcgacattacgtggtcttaataaattatggaatttaggccttacgattgat
caattagcagagcttggcgcagaaattggatcagatgtatcgttttgtgtatatggtggg
acagcaattgccactggaagaggagagcagattgagcacataaaaactccaccttcttgt
tgggttattttagcaaagcctcatattggtgtatctactgctgatgtatatggaaattta
aagttaaatcgagttacacatccaaatgtagataaaatggtggatgtcataaacgctgga
gactacaaagggatttgcgatactgttggtaacgttttagaagatgtaacgtttgctatg
catcctgaagttgcacgtattaaagcacaaatgaagcgatttggagcagatgctgtatta
atgagtggaagtggtccaactgtattcggcctagtgcaccatgattcgcgaatgcatcgt
atatataacggattaaaaggattttgtgaacaagtatacgcagtacgtttattaggagag
cgagaaacgcttgaataa

DBGET integrated database retrieval system