KEGG   Bacillus anthracis H9401: H9401_0067Help
Entry
H9401_0067        CDS       T02028                                 

Definition
Dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bax  Bacillus anthracis H9401
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H9401_0067
Enzymes [BR:bax01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     H9401_0067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
77497..78339
Genome map
AA seq 280 aa AA seqDB search
MCSLKWDYDLRCGEYTLNLNEKTLIMGILNVTPDSFSDGGSYNEVDAAVRHAKEMRDEGA
HIIDIGGESTRPGFAKVSVEEEIKRVVPMIQAVSKEVKLPISIDTYKAEVAKQAIEAGAH
IINDIWGAKAEPKIAEVAAHYDVPIILMHNRDNMNYRNLMADMIADLYDSIKIAKDAGVR
DENIILDPGIGFAKTPEQNLEAMRNLEQLNVLGYPVLLGTSRKSFIGHVLDLPVEERLEG
TGATVCLGIEKGCEFVRVHDVKEMSRMAKMMDAMIGKGVK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagtttgaagtgggattatgatttgcgctgcggcgaatatacattgaacttaaat
gaaaaaacattaattatggggattttaaatgtaacaccagattcgttttctgatggtggg
agttataatgaggtagatgctgcagtgcgccatgcgaaagaaatgcgagatgaaggtgct
catattattgatattggtggcgaatctactcgtccgggttttgctaaagtatcggtggaa
gaagaaataaaacgagttgttccgatgattcaggctgtttcaaaagaggtaaaattgcct
atttctatcgacacgtataaagctgaagttgcaaaacaagcaattgaagctggtgctcat
attattaatgatatttggggagcgaaggcagaaccaaaaatcgctgaagttgcagctcat
tacgatgtacctattatcttaatgcacaatcgcgataacatgaattatcgcaatttaatg
gctgatatgattgctgacttatatgacagtattaaaattgctaaagatgctggtgtgcga
gatgagaatatcattttagacccgggtatcggttttgctaaaacacctgaacaaaattta
gaagcgatgcgtaatttagaacagttaaacgtactaggttatccagttctcttaggtact
tcaagaaagtcctttattgggcatgtgctagatttaccggtagaagaacgtcttgaggga
acgggagctaccgtttgtcttggtattgaaaagggttgtgagtttgttcgcgttcatgat
gtgaaggaaatgtcgcgtatggctaagatgatggatgcgatgattggtaagggggtaaag
taa

DBGET integrated database retrieval system