KEGG   Bacillus anthracis H9401: H9401_0147Help
Entry
H9401_0147        CDS       T02028                                 

Definition
Arginase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bax  Bacillus anthracis H9401
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    H9401_0147
  Amino acid metabolism
   00330 Arginine and proline metabolism
    H9401_0147
Enzymes [BR:bax01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     H9401_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
152602..153495
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEVDV
NTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHPTLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFTMHEIDRMGMTAVMEETIEYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIVTSAEFVEVNMILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatttcggttattggagttccaatggatttagggcagatgcgtcgtgga
gttgatatgggaccgagcgcaatccgttatgcaggtgtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagaagtagatgta
aatacaagcttaagaaaccttacacaagttgcaactgtatgtaacgaattagcaagtaag
gtagatcatattatagaagaagggcgttttccacttgtattaggtggcgatcatagtatc
gctattggtacattagctggtgtggcgaaacattataaaaacctaggtgttatttggtac
gatgcacatggtgatttaaatacagaagaaacttcaccatctgggaatattcacggtatg
tcacttgcagcaagtttagggtatggacatcccacgcttgtagatttatacggggcatat
ccaaaggtgaaaaaagagaatgttgtcattatcggtgcacgtgcattagatgaaggagaa
aaagactttattcgcaatgaaggtattaaagtattcacaatgcacgagattgatcgtatg
ggtatgacagctgttatggaagaaacaattgaatatttatctcatactgacggtgtgcat
ttatcattagatttagatggtcttgatcctcatgatgcaccaggagttggaacacctgta
attggtggcctatcttatcgtgagagccatttagcaatggagatgttagcggaagctgat
attgttacatctgcggagtttgttgaggtaaatatgattttagatgagcgaaatagaacg
gcaacaacagcggttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system