KEGG   Bacillus anthracis H9401: H9401_0147Help
Entry
H9401_0147        CDS       T02028                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00220  Arginine biosynthesis
bax00330  Arginine and proline metabolism
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01130  Biosynthesis of antibiotics
bax01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    H9401_0147
   00330 Arginine and proline metabolism
    H9401_0147
Enzymes [BR:bax01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     H9401_0147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AFH81533
Position
152602..153495
Genome map
AA seq 297 aa AA seqDB search
MKKEISVIGVPMDLGQMRRGVDMGPSAIRYAGVIERIEEIGYDVKDMGDICIEREKEVDV
NTSLRNLTQVATVCNELASKVDHIIEEGRFPLVLGGDHSIAIGTLAGVAKHYKNLGVIWY
DAHGDLNTEETSPSGNIHGMSLAASLGYGHPTLVDLYGAYPKVKKENVVIIGARALDEGE
KDFIRNEGIKVFTMHEIDRMGMTAVMEETIEYLSHTDGVHLSLDLDGLDPHDAPGVGTPV
IGGLSYRESHLAMEMLAEADIVTSAEFVEVNMILDERNRTATTAVALMGSLFGEKLK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaaatttcggttattggagttccaatggatttagggcagatgcgtcgtgga
gttgatatgggaccgagcgcaatccgttatgcaggtgtaattgaaagaattgaagaaatt
ggatatgacgttaaagatatgggagatatatgtatagagagagaaaaagaagtagatgta
aatacaagcttaagaaaccttacacaagttgcaactgtatgtaacgaattagcaagtaag
gtagatcatattatagaagaagggcgttttccacttgtattaggtggcgatcatagtatc
gctattggtacattagctggtgtggcgaaacattataaaaacctaggtgttatttggtac
gatgcacatggtgatttaaatacagaagaaacttcaccatctgggaatattcacggtatg
tcacttgcagcaagtttagggtatggacatcccacgcttgtagatttatacggggcatat
ccaaaggtgaaaaaagagaatgttgtcattatcggtgcacgtgcattagatgaaggagaa
aaagactttattcgcaatgaaggtattaaagtattcacaatgcacgagattgatcgtatg
ggtatgacagctgttatggaagaaacaattgaatatttatctcatactgacggtgtgcat
ttatcattagatttagatggtcttgatcctcatgatgcaccaggagttggaacacctgta
attggtggcctatcttatcgtgagagccatttagcaatggagatgttagcggaagctgat
attgttacatctgcggagtttgttgaggtaaatatgattttagatgagcgaaatagaacg
gcaacaacagcggttgctttaatgggttctttattcggtgaaaaactaaaataa

DBGET integrated database retrieval system