KEGG   Bacillus anthracis H9401: H9401_0324Help
Entry
H9401_0324        CDS       T02028                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bax  Bacillus anthracis H9401
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bax00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
349882..350523
Genome map
AA seq 213 aa AA seqDB search
MLLQKEREEIVAYGKKMISSGLTKGTGGNISIFNREQGLVAISPSGLDYYETKPEDVVIL
NLDGEVVEGERKPSSELDMHLIYYRNREDINALVHTHSPYAKTIASLGWELPAVSYLIAF
AGPNVRCAPYETFGTKQLAEAAFEGMIDRRAVLLANHGLIAGANHIKMAFTVAEEIEFCA
QIYYQTKSIGEPKLLPEDEMENLAKKFEGYGQQ
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttattacaaaaagagagagaagagattgtagcgtacggaaagaaaatgatttctagc
ggtttaacaaaggggacaggcggtaatattagtattttcaatcgcgagcaaggtcttgtt
gccattagcccaagtggtttagattattatgaaacaaagcctgaagatgtagttatatta
aacttagatggtgaagtagtagagggagagagaaaaccatcaagtgaactcgatatgcac
cttatttattatagaaatcgtgaagatataaatgcgcttgtgcatacacattctccttat
gcgaagacgattgcatcattaggatgggaactgcccgcagtatcatatttaattgctttc
gcaggcccgaatgttcgctgtgcaccgtatgaaacatttggtacgaagcaattagcagag
gctgctttcgaaggaatgatcgatcgtcgtgctgttttacttgcgaaccacggtttaatt
gcgggtgcaaatcatatcaaaatggcatttaccgttgcagaagaaattgagttttgtgcg
caaatttattatcaaacgaaaagcattggggaaccgaagctattgccagaagacgagatg
gagaatttggcgaagaagtttgaagggtatgggcagcagtag

DBGET integrated database retrieval system