KEGG   Bacillus anthracis H9401: H9401_0637Help
Entry
H9401_0637        CDS       T02028                                 

Definition
Ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bax  Bacillus anthracis H9401
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    H9401_0637
Enzymes [BR:bax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     H9401_0637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
674258..675154
Genome map
AA seq 298 aa AA seqDB search
MPNIAVVGSISMDLVAVSKKRPKAGETVIGEAFHTIPGGKGANQAVAAARLGANVAMVGA
VGDDNYGTVVKRNLENERVFIDYVVPVTDAATGIAHIVLAEEDNSIVVVQGANALVNESV
VNRSKDLLIKADMVVLQLEIPLETVKYVLAICQEHKIPVMLNPAPAQVLSEDILEKATYI
TPNEHECRIVLDDFTSPIEDLLAKYPNKLLMTEGSNGVRFHNGTEIVHVPSIAVDVVDTT
GAGDTFNGALAVALSEGETLQKAIRFANIAGGLSVTKLGAQGGMPTRDRVREVQVIVG
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatattgcagtagtaggtagtatttcaatggacttagtggccgtttcaaaaaaa
cgtccgaaagcaggggaaacagtaattggtgaagcatttcatacaattccaggagggaaa
ggagctaaccaggcggttgctgcagctagattaggcgcaaatgtagcgatggttggagca
gtaggagacgataattatggaactgtagtgaagagaaatttagagaacgaacgcgttttt
atcgactatgtggtaccggttacagatgcggcgacaggaattgctcatatcgttttagca
gaagaggataacagtattgttgtcgtgcaaggggcgaatgctcttgtaaatgagtcggtt
gtaaatcgttcaaaagatcttcttataaaagctgatatggttgtgcttcaactagagatt
ccgcttgaaacagtaaaatatgtattggctatttgtcaggaacacaaaatcccggttatg
ttaaatccagcgccagcacaagtgttatcagaagatattttagaaaaggcaacttatatt
acaccaaatgaacatgagtgccgcatcgtattagatgatttcacatcgccaattgaagat
ttactggctaaatatccgaataaactattgatgacagaaggttctaacggtgtacgtttc
cataatggtacggagattgtacatgttcctagcattgctgttgatgtagtagatacgact
ggagctggtgatacatttaatggtgcattagcagttgcgctttctgaaggagaaacactt
caaaaagcaattcgttttgcgaatattgctggtggtctttctgtaacgaagcttggggcg
caaggcggtatgccaacgagagatagagtacgtgaagtgcaggtgattgtcgggtga

DBGET integrated database retrieval system