KEGG   Bacillus anthracis H9401: H9401_0972Help
Entry
H9401_0972        CDS       T02028                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bax  Bacillus anthracis H9401
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    H9401_0972
Enzymes [BR:bax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     H9401_0972
Exosome [BR:bax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H9401_0972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1006495..1007985
Genome map
AA seq 496 aa AA seqDB search
MKKYILSLDQGTTSSRAILFNKKGEIVHSAQKEFTQHFPKPGWVEHNAQEIWGSILAVIA
TCLSEADVKPEQIAGIGITNQRETAVVWDKTTGKPIYNAIVWQSRQTAEICDELKEKGYS
EMVREKTGLLIDAYFSGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGGKAHVT
DYSNASRTLMFNIHDLQWDDELLDMLTVPKSMLPEVRPSSEVYGETIDYHFFGQNVPIAG
VAGDQQAALFGQACFGEGMAKNTYGTGCFMLMNTGEKAVASEHGLLTTIAWGIDGKVNYA
LEGSIFVAGSAIQWLRDGMRMFKDASESEVYASRVESTDGVYVVPAFVGLGTPYWDSEVR
GAMFGVTRGTTKEHFIRATLESLAYQTKDVLCAMEADSGIELKTLRVDGGAVKNNFLMKF
QSDILDVPVERPVINETTALGAAYLAGLAVGYWKNQDEIKEQWHMDKRFEPTMEAETSEE
LYAGWKKAIEATKAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatattctttcattagaccaaggaacaactagctcacgcgcaattcttttc
aataaaaaaggtgaaattgttcattcagctcaaaaagaatttacacaacattttccaaag
ccaggctgggtagagcataacgcgcaagaaatttggggatctattttagcggttatcgca
acttgcttaagtgaagcagatgtaaagccagaacaaatcgctggtatcggtattacgaac
caacgtgaaacagcggttgtatgggataaaacgactggtaaaccaatttataacgcaatt
gtatggcaatctcgccaaacagctgaaatttgtgatgagttaaaagaaaaaggttatagc
gaaatggttcgcgaaaaaacaggtcttttaattgacgcatacttctctggtacgaaagta
aaatggattttagataacgttgaaggtgcaagagagaaagcagaaaacggcgatctatta
ttcggaacaattgatacgtggcttgtatggaaattatctggtggtaaagcgcacgtaacg
gattactcaaatgcatcacgtacattaatgtttaacattcacgacttacagtgggatgat
gagcttctagacatgttaacagtaccaaagagcatgcttccagaagtacgtccatcatct
gaagtgtatggagaaacaattgactatcacttcttcggtcaaaatgtaccgattgcaggt
gtagctggtgatcaacaagcggcattatttggacaagcttgtttcggtgaaggtatggcg
aaaaatacttacggaactggttgcttcatgttaatgaacacgggtgaaaaagcagtagct
tctgagcacggtctattaacaacaattgcatggggaatagatggtaaagtaaactacgca
ttagaaggaagtattttcgtagcgggttctgccattcagtggttacgtgacggaatgcgc
atgtttaaagatgcaagtgagagtgaagtatatgcttctcgtgttgaatcaactgacggt
gtatacgttgtaccagcattcgtaggattaggtacgccttactgggatagtgaagtacgc
ggcgctatgtttggtgtaacgcgcggtacgacgaaagaacacttcattcgtgcaacacta
gaatctttagcttaccaaacaaaagacgtattatgcgcaatggaagcagattcaggtatt
gaactaaaaacattacgcgttgatggcggagcagttaaaaataacttcttaatgaagttc
caaagtgatattttagacgttcctgtagagcgtccagtgatcaatgaaacaacagcttta
ggtgcagcgtacttagctggtcttgcggttggatattggaaaaaccaagatgaaattaaa
gaacagtggcatatggacaaacgctttgagccaacgatggaagcggaaacaagcgaagag
ctatatgctggatggaaaaaagcaattgaagcaacaaaagctttcaaataa

DBGET integrated database retrieval system