KEGG   Bacillus anthracis H9401: H9401_1067Help
Entry
H9401_1067        CDS       T02028                                 

Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bax  Bacillus anthracis H9401
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bax01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:bax00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bax00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1095850..1097409
Genome map
AA seq 519 aa AA seqDB search
MGEMLPAYNEILTPEALSFLKELHENFNERRIELLQKRMKKQQKIDAGEFPKFLEETKRI
READWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNSPTWENAIEGQ
INLRDAVKGTISHKNENGKEYRLNSKTAVLIVRPRGWHLEEKHMQVDGKNMSGSLVDFGL
YFFHNAKALLEKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTIKATVLLETIH
ASFEMDEILYELKDHSAGLNCGRWDYIFSFLKAFRNHNEFLLPDRAQVTMTAPFMRAYSL
KVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHDGTWVAHPGLV
PVAMEVFNHIMKTPNQIFRKREEIHVTEKDLLEVPVGTITEEGLRMNISVGIQYIASWLS
GRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELKEEELAKIERE
IGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgggagaaatgttaccagcgtacaacgaaatattgacacctgaggcgcttagtttttta
aaggaactacatgaaaattttaatgagcgccgcatagaacttttacaaaagcgtatgaaa
aaacaacagaaaattgatgcaggagagtttccgaagtttttagaagaaacaaagcgtata
cgtgaagcggattggacaattgctaaattgccaaaagatttagaggatcgccgcgtagag
attactggtccagtagatagaaagatggttattaacgctttaaattcgggagcacatctt
tttatggcggattttgaagattcgaattcaccaacttgggaaaatgcaattgaaggtcaa
ataaacttacgagatgcagtaaagggaacgatttcacataaaaatgaaaacggaaaagaa
tatcgtttaaatagtaaaacagctgtattaattgtgcgtccaaggggatggcatttagaa
gaaaaacatatgcaagttgacggaaaaaatatgtctggtagcttagtagatttcggactt
tattttttccataatgcgaaagctcttttagaaaaaggaagcggtccatacttttactta
ccgaaaatggaaagctatttagaagcaagattatggaatgatgttttcgtatttgctcaa
aaatatatcggtattccaaatggaacgatcaaagcaacggtgttactggaaacgattcac
gcttcgtttgaaatggatgaaattttgtatgagcttaaagatcattctgctggattaaat
tgcggaagatgggattatatttttagttttctaaaagctttccgtaatcataatgaattt
ttacttcctgatagagcgcaagtcacgatgacggcgccgtttatgcgcgcgtattctttg
aaagtcattcaaacttgtcaccgccgtaatgcaccagctattggagggatggcagcacaa
attccgattaaaaacaatcctgaagcgaatgaagctgcttttgaaaaagtgcgtgctgat
aaggagcgagaagctttagacggtcatgacgggacttgggttgcccacccgggacttgtg
ccagtcgcgatggaagtatttaatcacattatgaaaacaccgaatcaaatttttagaaaa
cgagaagaaatacatgttacagaaaaggatttattagaagtaccagtgggaacgattaca
gaagagggtcttcgtatgaatattagcgtaggcattcaatatatcgcatcttggttaagc
ggacggggagcagcaccaatttataacttaatggaagatgcggcaacagctgaaatctca
agagcacaagtatggcaatggattcgccatgaaggtggaaaattaaatgatggccgtaat
attacacttgaattaatggaagagttaaaagaagaagagttagcaaaaatagaaagagag
attggtaaagaagcctttaagaaagggagattccaagaggcgacaacgttgtttacaaat
ctcgttcggaatgatgaattcgtaccatttttaacattaccaggttatgaaattttataa

DBGET integrated database retrieval system