KEGG   Bacillus anthracis H9401: H9401_1067Help
Entry
H9401_1067        CDS       T02028                                 

Definition
Malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
bax  Bacillus anthracis H9401
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H9401_1067
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    H9401_1067
   00630 Glyoxylate and dicarboxylate metabolism
    H9401_1067
Enzymes [BR:bax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     H9401_1067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1095850..1097409
Genome map
AA seq 519 aa AA seqDB search
MGEMLPAYNEILTPEALSFLKELHENFNERRIELLQKRMKKQQKIDAGEFPKFLEETKRI
READWTIAKLPKDLEDRRVEITGPVDRKMVINALNSGAHLFMADFEDSNSPTWENAIEGQ
INLRDAVKGTISHKNENGKEYRLNSKTAVLIVRPRGWHLEEKHMQVDGKNMSGSLVDFGL
YFFHNAKALLEKGSGPYFYLPKMESYLEARLWNDVFVFAQKYIGIPNGTIKATVLLETIH
ASFEMDEILYELKDHSAGLNCGRWDYIFSFLKAFRNHNEFLLPDRAQVTMTAPFMRAYSL
KVIQTCHRRNAPAIGGMAAQIPIKNNPEANEAAFEKVRADKEREALDGHDGTWVAHPGLV
PVAMEVFNHIMKTPNQIFRKREEIHVTEKDLLEVPVGTITEEGLRMNISVGIQYIASWLS
GRGAAPIYNLMEDAATAEISRAQVWQWIRHEGGKLNDGRNITLELMEELKEEELAKIERE
IGKEAFKKGRFQEATTLFTNLVRNDEFVPFLTLPGYEIL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
gtgggagaaatgttaccagcgtacaacgaaatattgacacctgaggcgcttagtttttta
aaggaactacatgaaaattttaatgagcgccgcatagaacttttacaaaagcgtatgaaa
aaacaacagaaaattgatgcaggagagtttccgaagtttttagaagaaacaaagcgtata
cgtgaagcggattggacaattgctaaattgccaaaagatttagaggatcgccgcgtagag
attactggtccagtagatagaaagatggttattaacgctttaaattcgggagcacatctt
tttatggcggattttgaagattcgaattcaccaacttgggaaaatgcaattgaaggtcaa
ataaacttacgagatgcagtaaagggaacgatttcacataaaaatgaaaacggaaaagaa
tatcgtttaaatagtaaaacagctgtattaattgtgcgtccaaggggatggcatttagaa
gaaaaacatatgcaagttgacggaaaaaatatgtctggtagcttagtagatttcggactt
tattttttccataatgcgaaagctcttttagaaaaaggaagcggtccatacttttactta
ccgaaaatggaaagctatttagaagcaagattatggaatgatgttttcgtatttgctcaa
aaatatatcggtattccaaatggaacgatcaaagcaacggtgttactggaaacgattcac
gcttcgtttgaaatggatgaaattttgtatgagcttaaagatcattctgctggattaaat
tgcggaagatgggattatatttttagttttctaaaagctttccgtaatcataatgaattt
ttacttcctgatagagcgcaagtcacgatgacggcgccgtttatgcgcgcgtattctttg
aaagtcattcaaacttgtcaccgccgtaatgcaccagctattggagggatggcagcacaa
attccgattaaaaacaatcctgaagcgaatgaagctgcttttgaaaaagtgcgtgctgat
aaggagcgagaagctttagacggtcatgacgggacttgggttgcccacccgggacttgtg
ccagtcgcgatggaagtatttaatcacattatgaaaacaccgaatcaaatttttagaaaa
cgagaagaaatacatgttacagaaaaggatttattagaagtaccagtgggaacgattaca
gaagagggtcttcgtatgaatattagcgtaggcattcaatatatcgcatcttggttaagc
ggacggggagcagcaccaatttataacttaatggaagatgcggcaacagctgaaatctca
agagcacaagtatggcaatggattcgccatgaaggtggaaaattaaatgatggccgtaat
attacacttgaattaatggaagagttaaaagaagaagagttagcaaaaatagaaagagag
attggtaaagaagcctttaagaaagggagattccaagaggcgacaacgttgtttacaaat
ctcgttcggaatgatgaattcgtaccatttttaacattaccaggttatgaaattttataa

DBGET integrated database retrieval system