KEGG   Bacillus anthracis H9401: H9401_1068Help
Entry
H9401_1068        CDS       T02028                                 

Definition
Isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bax  Bacillus anthracis H9401
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H9401_1068
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    H9401_1068
Enzymes [BR:bax01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     H9401_1068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1097424..1098710
Genome map
AA seq 428 aa AA seqDB search
MEQMKNERIEKLQESWELDTRWKGITRPYSAEDVIRLRGSIDIEHTLARRGAEKLWASLH
TEDYINALGALTGNQAMQQVKAGLKAIYLSGWQVAADANLSGHMYPDQSLYPANSVPAVV
KRINQTLQRADQIQHMEGSGDTDYFVPIVADAEAGFGGQLNVFELMKGMIEAGASGVHFE
DQLSSEKKCGHLGGKVLLPTQTAVRNLISARLAADVMGVPTIIVARTDADAADLITSDID
PVDKAFITGERTPEGFYRTKAGLDQAIARGLAYAPYADLVWCETSEPNLEDAKRFADAIH
KEHPGKLLAYNCSPSFNWKQKLDEKTIASFQKEIASYGYKFQFVTLAGFHSLNYGMFELA
RGYKERGMAAYSELQQAEFAAEKHGYSATRHQREVGTGYFDEVAQVITGGTSSTTALKGS
TEEAQFTK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaatgaaaaacgaaagaatcgagaaattacaagagagctgggaattagatacg
cgttggaaagggattacacgtccatattcggcagaagatgtaattcgcctgcgcggatca
attgatatcgagcatacattagcgcgccgcggtgctgaaaagctttgggcatcgcttcat
acagaagattacattaacgcacttggggcattaacaggaaaccaagcgatgcaacaagta
aaagctgggttaaaagcaatttatttaagtggatggcaagtagcggccgatgcaaacctg
tctggacatatgtatccagaccaaagtttatatccagcgaacagcgtacctgctgtcgta
aaacgaattaatcaaacacttcaacgtgcggatcaaattcagcatatggaaggaagcggt
gatacagattatttcgtgccaattgtagcagatgcagaagctggatttggcggacaatta
aacgtatttgaactgatgaaaggtatgattgaagcgggtgcgtctggcgtgcactttgaa
gatcaattatcttcagagaagaaatgcggtcatttaggcggaaaagtattactaccaacg
caaacagcagtgcgtaatttaatttcggcacgccttgctgcagacgtaatgggagtgccg
acaattatcgttgcaagaacagatgcggatgcagcagatttaattacgagcgatatcgat
cctgttgataaagcgtttattacaggagaaagaacaccagaaggattttaccgtacgaaa
gcaggtcttgaccaagcgattgcacgtggtttagcgtacgctccttacgcagacctcgtt
tggtgtgaaacttcagaaccaaatttagaagatgcaaaacgatttgcggacgcaattcat
aaggagcatccagggaagctacttgcatataactgctcaccttcattcaactggaaacaa
aaactagatgaaaaaacaattgcaagcttccaaaaggaaatcgcatcttacggttacaag
ttccaattcgtaacacttgctggattccattcattaaattacggtatgtttgaactagca
cgtggctataaagagcgcggcatggcagcatactctgaactacaacaagcagaattcgca
gctgaaaaacacggctactctgcaacacgtcatcaacgcgaagtaggaacaggttacttt
gatgaagtggcacaagtgattacaggcggaacttcatcaacgacagcgttaaaaggatct
acagaagaagcacagtttacgaaataa

DBGET integrated database retrieval system