KEGG   Bacillus anthracis H9401: H9401_1155Help
Entry
H9401_1155        CDS       T02028                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
bax  Bacillus anthracis H9401
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    H9401_1155
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    H9401_1155
Enzymes [BR:bax01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     H9401_1155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
1178643..1179188
Genome map
AA seq 181 aa AA seqDB search
MKVIETNFTDAKLLEPRLFGDDRGFFTESYNKKVLETLGVTHSFVQDNVSYSAEAGTIRG
LHFQKNPKAQTKLIQVMQGAIYDVIVDLRKDSPTFKQWRGYILSADNHRQLLVPKGFAHG
FCTLVPHTIVMYKVDEYYSADHDSGVLWNDKELAIPWPVTSPILSDKDRILPLLQECEDS
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttatagaaacaaactttaccgacgcaaaattgttggaaccgaggttatttgga
gatgatcgtggcttttttactgaaagttataataagaaggtgctagaaacattaggggtt
acgcattcatttgtacaggataatgtctcgtattcagcagaagcgggaacgattcgcgga
ttacattttcaaaaaaatccgaaagcacaaacgaaacttattcaagttatgcaaggagca
atctatgacgttatcgtagatttgagaaaggattcaccaacgtttaaacagtggagagga
tatattttaagtgcggataatcatcggcaattattagtgccaaaaggatttgcacatggt
ttttgtacacttgtcccgcatacgattgttatgtataaagtagatgagtattatagtgcc
gatcatgactcaggggtactttggaacgataaagaattagcaattccatggccggtaaca
agtcctattttgtctgataaagatcgaatattaccattacttcaggaatgtgaagatagc
ttttga

DBGET integrated database retrieval system