KEGG   Bacillus anthracis H9401: H9401_1192Help
Entry
H9401_1192        CDS       T02028                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00020  Citrate cycle (TCA cycle)
bax00310  Lysine degradation
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01120  Microbial metabolism in diverse environments
bax01130  Biosynthesis of antibiotics
bax01200  Carbon metabolism
Module
bax_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bax_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    H9401_1192
  Amino acid metabolism
   00310 Lysine degradation
    H9401_1192
Enzymes [BR:bax01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     H9401_1192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N Orai-1
Motif
Other DBs
NCBI-ProteinID: AFH82578
Position
complement(1213963..1215219)
Genome map
AA seq 418 aa AA seqDB search
MIEIKVPELAESITEGTISQWLLNVGDKVEKGGSVVELETDKVNVEIIAEDSGIVSKLLG
EPGDTVEVGATIAILDANGAPVAVSTPAPAEQSKQETAEAPKAAAPSAEQTATLQGLPNT
NRPIASPAARKMARELGIDLNDVRSTDPLGRVRPHDVQAHAAAPKEAPAAPKSPAPAPVA
KTEFEKPVERVKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAIMELRKERKDAFEKKH
DVRLGFMSFFTKAVVAALKQFPLLNAEIQGDELIIKKFYDIGIAVAAPDGLVVPVVRDAN
QLNFAEIESEIRELGKKARDNKLSLKELQGGTFTITNGGVFGSLMSTPILNSPQVGILGM
HKIQVRPVAIDNERMENRPMMYIALSYDHRIVDGKEAVSFLVAVKDMLEDPKSLLLEG
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgatcgaaattaaagtacctgagcttgcagaatctattactgaaggaactatctcacaa
tggcttctcaacgtaggcgacaaagttgagaaaggtggcagcgttgttgagcttgaaact
gataaagtcaatgtagaaatcattgcagaagattcaggtattgtatcgaagttactaggc
gaacctggggatacagttgaagttggcgcaactatcgcaattttagacgcaaacggagca
ccagttgcagtaagtacacctgcaccggctgagcaatcgaaacaagaaacagctgaagca
ccaaaagctgcggcaccaagtgctgaacaaactgcaactctacaaggtttaccaaataca
aaccgtcctatcgcatcaccagctgctagaaaaatggctcgtgaattaggaatcgactta
aacgacgtacgtagcacagatccacttggccgtgtgagaccacacgatgtacaagctcat
gctgcagcaccaaaagaagcaccagctgctccaaaaagtccagctcctgctccagttgca
aaaactgaattcgaaaaaccagttgagcgcgtgaaaatgtcccgccgccgtcaaacaatt
gcaaaacgtcttgtagaagttcaacaaacatctgcaatgttaacaacatttaacgaagtt
gatatgactgcaatcatggaattacgtaaagagcgtaaagatgctttcgagaaaaaacat
gatgtacgtcttggtttcatgtcattcttcacaaaagcagttgttgcagcattaaaacaa
ttcccattattaaatgctgaaattcaaggcgacgagcttatcattaaaaaattctatgat
atcggtattgcagtagcagctccagatggattagttgttccagttgtacgcgatgcgaac
caattaaacttcgctgaaatcgaaagcgaaattcgtgaattaggtaaaaaagcacgtgat
aacaaactttcattaaaagaactacaaggtggtacatttacaattacaaacggtggtgtg
ttcggttctctaatgtcaacaccgatcctaaacagcccacaagttggtattttaggaatg
cacaaaatccaagtacgtccagttgcaatcgataacgaacgtatggaaaaccgcccaatg
atgtacatcgctttatcttacgatcaccgtattgttgatggtaaagaagcagttagcttc
cttgttgctgttaaagatatgcttgaagatccaaaatcattattattagaaggttga

DBGET integrated database retrieval system