KEGG   Bacillus anthracis H9401: H9401_1338Help
Entry
H9401_1338        CDS       T02028                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00340  Histidine metabolism
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01230  Biosynthesis of amino acids
Module
bax_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    H9401_1338
Enzymes [BR:bax01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     H9401_1338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFH82724
Position
1341204..1342493
Genome map
AA seq 429 aa AA seqDB search
MEIVCEDFQKALTKIKLLRENANIIEETVQRSVREIVQNVRESRDEALSFYTKKFDGVEI
KDVRVSEEEIKQASMFVESSFLEALQEAKKNIISYHEKQKRQSMFDCTSKGIIRGQIIRP
LENIGVYVPGGTASYPSSVLMNVLPAKLAGVKKIVMVTPPRAGGIDPHILVAASLAGVDE
IYMIGGAQAIAALAYGTESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVIA
DETGNAKYIAADLLSQAEHDERATAICITTNIELAKEVEKEIERQLETLPRSEIARESIN
RNGAIFIVPSIDEALQLSNEIAPEHLELHIKEPMNALAYVKHAGSIFLGPYAPEPLGDYL
AGPNHVLPTSGTARFFSPLSVDDFVKKSSFLSYTEGALRDVKHHIVELANKEGLHAHARA
IQIRFGEEE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggagatagtttgtgaggattttcaaaaggcgttaacgaaaataaaactgttacgagaa
aacgctaatataatagaagaaactgttcaaagaagtgtcagggaaatcgttcagaatgta
agagagagtagagatgaggcgttatctttctatacaaaaaagtttgatggtgtagagatt
aaagatgttcgtgtaagtgaagaagaaataaaacaagcgagtatgtttgtagagagttca
tttttagaagcgttacaagaggcgaagaaaaacattatttcgtaccatgaaaagcaaaaa
agacaatcgatgtttgattgcacgagtaaaggcatcataaggggacaaatcattcggccg
ttagaaaatataggggtatatgtgccaggcggaactgcttcgtatccttcgtcagtatta
atgaatgtattgccagcaaagctcgcgggtgtgaaaaagattgtaatggtaacaccgcca
agagcaggaggaattgatccgcatattttagttgctgcaagccttgcaggagtagatgaa
atttatatgataggtggcgcgcaagcaattgctgctttagcatacgggacggaatcgatt
ccaaaagtagataaaatagttggaccaggaaatttgtacgtcgctctagcgaaacgagaa
gtatacggaatagtaaatatcgatatgattgctggaccgtcagaaatagtagttattgct
gatgaaactggcaatgcaaaatatattgctgcagatttattatcacaagcagaacatgat
gagagagcgacagcaatttgtattacaacgaatatagaattagcaaaagaagtagaaaaa
gagatagaaaggcagttagaaacattaccaagaagcgaaattgcacgtgaatcaataaat
agaaatggagccatttttatcgttccttctatagatgaggcactacagttatcgaatgaa
atcgccccggaacatttagagttacatataaaagaaccgatgaatgctctagcttatgtg
aaacatgcaggatctatctttcttggaccgtatgcaccagaaccgctcggtgattattta
gcgggaccgaatcatgtattaccgacaagtggaacggcaaggtttttctcgccgttatca
gtcgatgatttcgtgaaaaaatcaagttttctatcttatacggagggagcattaagagat
gtaaaacatcatattgtagaacttgccaataaagaagggctacatgcgcatgcgagagca
attcaaataagatttggggaggaagaataa

DBGET integrated database retrieval system