KEGG   Bacillus anthracis H9401: H9401_1338Help
Entry
H9401_1338        CDS       T02028                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
bax  Bacillus anthracis H9401
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bax01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:bax00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1341204..1342493
Genome map
AA seq 429 aa AA seqDB search
MEIVCEDFQKALTKIKLLRENANIIEETVQRSVREIVQNVRESRDEALSFYTKKFDGVEI
KDVRVSEEEIKQASMFVESSFLEALQEAKKNIISYHEKQKRQSMFDCTSKGIIRGQIIRP
LENIGVYVPGGTASYPSSVLMNVLPAKLAGVKKIVMVTPPRAGGIDPHILVAASLAGVDE
IYMIGGAQAIAALAYGTESIPKVDKIVGPGNLYVALAKREVYGIVNIDMIAGPSEIVVIA
DETGNAKYIAADLLSQAEHDERATAICITTNIELAKEVEKEIERQLETLPRSEIARESIN
RNGAIFIVPSIDEALQLSNEIAPEHLELHIKEPMNALAYVKHAGSIFLGPYAPEPLGDYL
AGPNHVLPTSGTARFFSPLSVDDFVKKSSFLSYTEGALRDVKHHIVELANKEGLHAHARA
IQIRFGEEE
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atggagatagtttgtgaggattttcaaaaggcgttaacgaaaataaaactgttacgagaa
aacgctaatataatagaagaaactgttcaaagaagtgtcagggaaatcgttcagaatgta
agagagagtagagatgaggcgttatctttctatacaaaaaagtttgatggtgtagagatt
aaagatgttcgtgtaagtgaagaagaaataaaacaagcgagtatgtttgtagagagttca
tttttagaagcgttacaagaggcgaagaaaaacattatttcgtaccatgaaaagcaaaaa
agacaatcgatgtttgattgcacgagtaaaggcatcataaggggacaaatcattcggccg
ttagaaaatataggggtatatgtgccaggcggaactgcttcgtatccttcgtcagtatta
atgaatgtattgccagcaaagctcgcgggtgtgaaaaagattgtaatggtaacaccgcca
agagcaggaggaattgatccgcatattttagttgctgcaagccttgcaggagtagatgaa
atttatatgataggtggcgcgcaagcaattgctgctttagcatacgggacggaatcgatt
ccaaaagtagataaaatagttggaccaggaaatttgtacgtcgctctagcgaaacgagaa
gtatacggaatagtaaatatcgatatgattgctggaccgtcagaaatagtagttattgct
gatgaaactggcaatgcaaaatatattgctgcagatttattatcacaagcagaacatgat
gagagagcgacagcaatttgtattacaacgaatatagaattagcaaaagaagtagaaaaa
gagatagaaaggcagttagaaacattaccaagaagcgaaattgcacgtgaatcaataaat
agaaatggagccatttttatcgttccttctatagatgaggcactacagttatcgaatgaa
atcgccccggaacatttagagttacatataaaagaaccgatgaatgctctagcttatgtg
aaacatgcaggatctatctttcttggaccgtatgcaccagaaccgctcggtgattattta
gcgggaccgaatcatgtattaccgacaagtggaacggcaaggtttttctcgccgttatca
gtcgatgatttcgtgaaaaaatcaagttttctatcttatacggagggagcattaagagat
gtaaaacatcatattgtagaacttgccaataaagaagggctacatgcgcatgcgagagca
attcaaataagatttggggaggaagaataa

DBGET integrated database retrieval system