KEGG   Bacillus anthracis H9401: H9401_1441Help
Entry
H9401_1441        CDS       T02028                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
bax  Bacillus anthracis H9401
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H9401_1441
Enzymes [BR:bax01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     H9401_1441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1438345..1438914
Genome map
AA seq 189 aa AA seqDB search
MAKVNLEQIEHAVRLILEAIGDDPNREGVLDTPKRVAKMYAEVFSGMHEDPKEHLHKVFG
EDHEELVLVKDIPFYSMCEHHLVPFYGVAHVAYIPQGGKVTGLSKLARTVDTIARRPQLQ
ERITSTVANSIMEVLEPHGVMVVVEAEHMCMTMRGVKKPGAKTVTTAVRGVLENDAAARS
EILSFIKTK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaagttaatttagaacaaattgaacatgcagtacgccttattttagaggcaatt
ggagatgaccctaatcgagagggagtacttgatacaccaaagcgtgttgcaaaaatgtac
gcagaagtgttctcaggtatgcatgaagatccgaaagaacatttacacaaagtgttcgga
gaagatcatgaggagcttgtactagtaaaagatataccgttttattcgatgtgtgagcat
catttagttccattctatggagttgctcacgttgcatatattccgcaaggcggaaaagtg
acagggttaagtaaattagctcgtactgtagatacaattgcacgtcgtccacaactgcaa
gaacgtattacatcaacagtagcgaactctattatggaagtactagagccgcatggtgta
atggtagtagtagaagcggaacatatgtgtatgacgatgcgcggtgtgaaaaagccaggt
gcaaaaacagtaacaacagcagtgcgtggtgtgctagaaaatgatgctgcagcacgtagt
gaaattttatcttttattaaaacgaagtaa

DBGET integrated database retrieval system