KEGG   Bacillus anthracis H9401: H9401_1650Help
Entry
H9401_1650        CDS       T02028                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bax  Bacillus anthracis H9401
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H9401_1650
   01230 Biosynthesis of amino acids
    H9401_1650
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H9401_1650
  Energy metabolism
   00680 Methane metabolism
    H9401_1650
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H9401_1650
Enzymes [BR:bax01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     H9401_1650
Exosome [BR:bax04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   H9401_1650
  Exosomal proteins of melanoma cells
   H9401_1650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1628251..1628826
Genome map
AA seq 191 aa AA seqDB search
MTTIYFVRHAHSTYTKEERERPLSEKGHCDAENVTSLLKDKHIDVVISSPYKRAVQTVQG
IANTYHVSIEIEEGLRERLLSSEPIADFNDAIENVWEDWSFAYEGGESNDVAQRRAVICM
QSILKKYKGKNIVIGTHGNIMVLLMNYFDSKYDFRFWKTLRMPDIFKLNFHNEDLVSAER
IENTGHQINNL
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacaacaatatatttcgttcgccatgcccattctacatatacaaaagaagaacgggag
cgtcctttatctgaaaaagggcactgtgatgcagaaaacgttacgagcttattaaaagat
aaacacattgatgtagtgatttctagcccgtacaaaagagcagttcaaactgtacaagga
attgcgaatacatatcatgtatcaatagaaatagaagaaggtttacgagaaaggttatta
agttcagagccaatagcagattttaatgatgctattgagaatgtgtgggaagattggagt
tttgcatacgaaggcggagaatccaatgatgtagcacaaagacgcgctgtaatatgtatg
caaagtatattaaaaaaatataaaggtaaaaatattgtaataggtacgcatgggaatatt
atggtattacttatgaattattttgattcaaaatatgattttcgattttggaaaacactt
cgtatgcccgatatatttaagttgaattttcataatgaagatttagtttctgccgaaagg
atagagaatacgggtcatcagataaataatttgtaa

DBGET integrated database retrieval system