KEGG   Bacillus anthracis H9401: H9401_1866Help
Entry
H9401_1866        CDS       T02028                                 

Definition
(RefSeq) Threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bax  Bacillus anthracis H9401
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    H9401_1866
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H9401_1866
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    H9401_1866
Enzymes [BR:bax01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     H9401_1866
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1842349..1843407
Genome map
AA seq 352 aa AA seqDB search
MYKGLLNQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGIQLYGKYEGANPTGSFKD
RGMVMAVAKAKEEGSEAIICASTGNTSASAAAYAARLGMKCIIVIPEGKIAHGKLAQAVA
YGAEIISIEGNFDDALKAVRNIAEEEPITLVNSVNPYRIEGQKTAAFEICDQLQRAPDVL
AIPVGNAGNITAYWKGFCEYEKEKGYKKPRIHGFEAEGAAAIVKGHVIDEPETIATAIRI
GNPASWSYAVEAAEQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHVQS
GKIKKGETVVAVLTGNGLKDPDIAISSNTLDIASVSNNIEQIKEHIKGVIMS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagggctattaaaccaatatgcttcttatttaccggtaaatgaaaacacacca
gatgtgagcttaatggaaggaaatacaccccttattccgttattaaacatatcaaaacaa
ttagggattcagttatacgggaagtatgaaggagcgaatccgacaggttcttttaaagat
cgaggcatggtaatggctgttgcgaaggcgaaagaagaaggttcggaggcaatcatttgt
gcatcgacaggtaatacatcagcatcggctgccgcatacgcggcacgccttggaatgaaa
tgtattatcgtaataccggaaggaaagattgcacatggaaaattagcacaagcagttgcg
tatggtgctgaaatcatttcaatagaaggaaattttgatgatgcattaaaggctgtaaga
aatatcgctgaggaagagccgattacgttagtaaactcagtgaatccttatcgaattgaa
gggcaaaaaacagcagcgtttgaaatttgtgatcagttgcaacgtgcaccagatgtttta
gcgattcctgttgggaatgccggaaatattacagcgtactggaaaggtttctgtgaatat
gagaaagaaaaaggttataaaaagccaagaattcatgggtttgaagcggaaggagcagct
gcaattgtaaaagggcatgtaattgacgagccagaaacaattgcaactgcgattcgcatc
ggtaacccagcaagttggtcatatgcggtagaggctgctgagcaatctcacggcgaaata
gatatggtatcagatgaagagattttacatgcgtatagattattagcaaaatcggaaggg
gttttcgctgagccaggatcaaatgcttcattagccggtgtaatgaaacatgttcaatct
ggaaaaatcaaaaagggagaaacagttgttgcagttttaactggaaatggcttgaaagat
cctgatatcgcaatttcttctaatacattagatattgcaagtgtttcaaataatatagaa
caaattaaagagcatattaaaggggtgattatgtcgtga

DBGET integrated database retrieval system