KEGG   Bacillus anthracis H9401: H9401_1970Help
Entry
H9401_1970        CDS       T02028                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bax  Bacillus anthracis H9401
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H9401_1970
   01230 Biosynthesis of amino acids
    H9401_1970
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H9401_1970
  Energy metabolism
   00680 Methane metabolism
    H9401_1970
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H9401_1970
Enzymes [BR:bax01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     H9401_1970
Exosome [BR:bax04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   H9401_1970
  Exosomal proteins of melanoma cells
   H9401_1970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1935162..1935752
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTEKGRQQVQRLVQKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPIQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSLLRAFFKMPISMDYYFKMGDTGISLIEIDGE
QKTVHFINDTNHLHGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatattttaaacgtacatgaa
ggacgagctgactttgaattaacagaaaagggaagacagcaagtgcaaagacttgtacag
aaagtgaaagcagattttccaccagatttcatttgggcaagtacattaaaacgcgctcga
gaaactggtgaaacgttagcagaaggaattgggtgcccaattcaattagaagaggaatta
atggagtttaataatggagtgcaagcaggtctttcatttgaagaagctaagaaatatccc
gagccaaagtttcttcatgatcgttttgaaaacggggaatcatttattgaatttagaatg
agaatagaaggcatcttttctaaaatcgtgacggagaatacatatgaccgaattgcaatt
gttgcacacggtggtgtaataaatagtctattacgtgcgtttttcaaaatgccaatttca
atggactattattttaaaatgggagatacgggaataagcttaattgaaattgacggtgaa
caaaaaacggtacatttcattaatgatacgaatcatttgcacgggatgtag

DBGET integrated database retrieval system