KEGG   Bacillus anthracis H9401: H9401_1970Help
Entry
H9401_1970        CDS       T02028                                 

Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00010  Glycolysis / Gluconeogenesis
bax00260  Glycine, serine and threonine metabolism
bax00680  Methane metabolism
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01120  Microbial metabolism in diverse environments
bax01130  Biosynthesis of antibiotics
bax01200  Carbon metabolism
bax01230  Biosynthesis of amino acids
Module
bax_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bax_M00002  Glycolysis, core module involving three-carbon compounds
bax_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H9401_1970
  Energy metabolism
   00680 Methane metabolism
    H9401_1970
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    H9401_1970
Enzymes [BR:bax01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     H9401_1970
Membrane trafficking [BR:bax04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    H9401_1970
Exosome [BR:bax04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   H9401_1970
  Exosomal proteins of melanoma cells
   H9401_1970
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AFH83356
Position
1935162..1935752
Genome map
AA seq 196 aa AA seqDB search
MQILLIRHGESEADILNVHEGRADFELTEKGRQQVQRLVQKVKADFPPDFIWASTLKRAR
ETGETLAEGIGCPIQLEEELMEFNNGVQAGLSFEEAKKYPEPKFLHDRFENGESFIEFRM
RIEGIFSKIVTENTYDRIAIVAHGGVINSLLRAFFKMPISMDYYFKMGDTGISLIEIDGE
QKTVHFINDTNHLHGM
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatactactaatacgccacggagaatcagaagctgatattttaaacgtacatgaa
ggacgagctgactttgaattaacagaaaagggaagacagcaagtgcaaagacttgtacag
aaagtgaaagcagattttccaccagatttcatttgggcaagtacattaaaacgcgctcga
gaaactggtgaaacgttagcagaaggaattgggtgcccaattcaattagaagaggaatta
atggagtttaataatggagtgcaagcaggtctttcatttgaagaagctaagaaatatccc
gagccaaagtttcttcatgatcgttttgaaaacggggaatcatttattgaatttagaatg
agaatagaaggcatcttttctaaaatcgtgacggagaatacatatgaccgaattgcaatt
gttgcacacggtggtgtaataaatagtctattacgtgcgtttttcaaaatgccaatttca
atggactattattttaaaatgggagatacgggaataagcttaattgaaattgacggtgaa
caaaaaacggtacatttcattaatgatacgaatcatttgcacgggatgtag

DBGET integrated database retrieval system