KEGG   Bacillus anthracis H9401: H9401_2124Help
Entry
H9401_2124        CDS       T02028                                 

Definition
Dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bax  Bacillus anthracis H9401
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H9401_2124
   00670 One carbon pool by folate
    H9401_2124
Enzymes [BR:bax01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     H9401_2124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2079177..2079650
Genome map
AA seq 157 aa AA seqDB search
MVAMDENRVIGKDNNLPWRLPSELQYVKKTTMGHPLIMGRKNYEAIGRPLPGRRNIIVTR
NEGYHVEGCEVAHSVEEVFELCKNEEEIFIFGGAQIYDLFLPYVDKLYITKIHHAFEGDT
FFPEMDMTNWKEVFVEKGLTDEKNPYTYYYHVYEKQQ
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggtcgcaatggacgaaaatagagtaattggtaaagataataatttaccttggcgttta
ccgagtgaattgcagtatgtaaagaaaacaacgatgggtcacccgcttattatgggaaga
aaaaactatgaagcgattggtagaccactgcctggaagacgtaatattattgtaactcgc
aatgaaggatatcatgttgaaggctgtgaagtagcacattctgtagaagaagtgtttgag
ctatgcaaaaatgaagaagagatctttatttttggcggagcacaaatttatgatctcttt
ttaccttacgtagacaagttatatataacaaaaatccatcatgcatttgaaggagataca
tttttcccagaaatggatatgacaaattggaaagaagtttttgttgaaaaaggtttaacg
gatgaaaaaaatccgtatacgtattattaccatgtatatgagaaacaacaataa

DBGET integrated database retrieval system