KEGG   Bacillus anthracis H9401: H9401_2153Help
Entry
H9401_2153        CDS       T02028                                 

Definition
Alcohol dehydrogenase, zinc-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bax  Bacillus anthracis H9401
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    H9401_2153
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H9401_2153
  Lipid metabolism
   00071 Fatty acid degradation
    H9401_2153
  Amino acid metabolism
   00350 Tyrosine metabolism
    H9401_2153
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    H9401_2153
   00626 Naphthalene degradation
    H9401_2153
Enzymes [BR:bax01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     H9401_2153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2102481..2103518
Genome map
AA seq 345 aa AA seqDB search
MKAVVVNKNSKANIEVVEKELRPLHSGEALVDVEYCGVCHTDLHVANHDFGNTDGRILGH
EGVGIVTKIADDVTSLKVGDRVSIAWMFQSCGRCEYCVTGRETFCREVKNAGYSVDGGMA
EQCIVTADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSDIKPGQPIVIYGCGGLGNLAI
QYAKNVFGAKVIAVDINDDKLALAKEVGADMTINPISQGPADKIIQEEFGGAYAAVVTAV
SKVAFNSAVDAVRACGKVVAVGLPVETMDLNIPRLVLDGIEVVGSLVGTRKDLEEAFMFG
AEGKVVPVVQTCSLDKVQNVFEEMEQGRIQGRMVIDFKQNNCDCK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtagtagttaataaaaatagtaaagccaatattgaggttgttgaaaaggaa
ttacgtccgctacactcaggtgaagcactagtagatgtagagtattgtggggtttgtcat
actgatttacacgttgcaaatcatgattttggaaacacagatggccgtattcttggtcat
gagggtgtaggtattgtgacgaaaatcgctgatgatgttacttcactaaaggtaggtgat
cgtgtaagtattgcatggatgttccaatcttgtggacgttgtgaatattgcgtgactggt
agagaaacattttgccgtgaagttaagaatgctggttattcagtagatggtggtatggct
gaacaatgtattgttacagctgattatgcagtgaaagtaccagaaggattagatcctgct
caagcatcatcgatcacatgtgcgggcgttactacatataaagctataaaagtatctgat
attaaacctggtcaaccgatcgtaatctatggttgtggtggattaggtaacttagctatc
caatatgctaaaaatgtatttggtgcaaaggtaattgcagtagatattaatgacgataaa
ctagccttagcaaaagaggttggtgctgatatgacaatcaatccaatttctcaaggtcct
gctgataagattattcaagaggagtttggtggtgcttatgctgctgtagtaacagctgtt
tcaaaggtagcattcaactcagcagttgacgcagtacgtgcttgtggtaaagtcgttgca
gtaggtttaccagtagaaactatggatttgaacattccgcgccttgtactagatggaatt
gaagtagttggttctttagtcggtactcgtaaggatctagaagaggcgtttatgttcggg
gcagaaggaaaagtagtgccagttgttcaaacttgttctttagataaagtacaaaatgta
ttcgaagaaatggaacaaggtagaattcaagggcgtatggtaatcgattttaaacagaac
aattgtgattgcaaataa

DBGET integrated database retrieval system