KEGG   Bacillus anthracis H9401: H9401_2429Help
Entry
H9401_2429        CDS       T02028                                 

Definition
Acetoacetyl-CoA synthase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bax  Bacillus anthracis H9401
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    H9401_2429
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    H9401_2429
   00620 Pyruvate metabolism
    H9401_2429
   00640 Propanoate metabolism
    H9401_2429
  Energy metabolism
   00680 Methane metabolism
    H9401_2429
Enzymes [BR:bax01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     H9401_2429
Lipid biosynthesis proteins [BR:bax01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   H9401_2429
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2366722..2368662
Genome map
AA seq 646 aa AA seqDB search
MKQAVWFPTEEYKEKTRLYGWMKSLGYEDYETFYNKSIEETAWFWGEAEKVVGYQWMKPY
TEVLDLQNGTPFAQWYNGGTCNVVESVLSRWLADDETRTQPALQYEGENGTSKSFTYEEL
DSWVSRAANGLKHAGIEKGDRVTIYMPMIPETVVAMLAVMKIGAIISPIFSGFASDAVMT
RVQAAGSKMIITADGFSRRGKIVSLKDEVDKACEHCPTVEKVVIVRHAGNDFTPHNYDFS
WSTLEKEKPFVHAEEMHSDDPLMLIYTSGTTGKPKGTVHTHAGFPLKAAFDAGFGMNIKQ
GDRVLWVTDMGWMMGPFLLFGSLINGATMVMYEGVPDFPKADRLWETVDKYEITHLGISP
TLIRALMAKGDEYVNKHSLKSLEVFASTGEPWNPDPWMWLFETVGKSNVPICNYSGGTEI
SGGIFGNVLIKPIAPISFNASLPGMAAVVLDDQGNPIRDEVGELCLEKPWVGMTKSFWED
DERYVNTYWSRFENKWVHGDWVVYDGEQYIITGRSDDTLNIAGKRIGPAEYESILVKHND
VIEAAAIGVPDDVKGEVCHCFVVLRDNVTFTGELKKELMSLVNSHIGKALCPKDIHVVED
LPKTRNSKVMRRVIKAAYLGKELGDLSSLVNPEVVPFIQGLQSSKL
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaagcagtttggtttccaacagaagagtataaagaaaaaacacgcttatatggt
tggatgaaatcattggggtatgaagattatgaaacgttttataataaatctattgaagaa
acagcttggttttggggagaagctgagaaagtggttggctatcaatggatgaaaccttat
acagaagtgttagacctgcaaaatggtacaccgtttgcacagtggtataatggcggaaca
tgtaacgttgtagaatcagttttatcacgctggcttgcagatgatgaaacaagaacgcaa
ccagcacttcagtatgaaggagaaaatggaacttcaaaatcatttacatatgaagaactt
gatagctgggtaagtcgcgctgcaaatggtttgaaacatgcgggtattgaaaaaggcgac
cgagtaacaatttatatgccaatgattccagaaacagttgttgcgatgctagctgtaatg
aaaatcggagcaattatttcaccaatattctcaggatttgcgtctgatgcagtcatgaca
cgcgtgcaagcagcaggatcaaagatgatcattactgcagatggtttttcacgccgaggt
aagattgtttcattaaaagatgaagtagataaagcttgtgagcattgtccaactgttgaa
aaagtcgttatcgtgcgccacgcaggaaatgattttacaccgcataattatgatttctca
tggagtacgttagaaaaagaaaagccatttgtacatgctgaagaaatgcatagtgacgat
ccgttaatgctcatttatacatcaggtacaacaggaaaaccgaaagggaccgtgcacact
catgctggtttccctttgaaagcagcatttgatgcagggtttgggatgaatataaaacaa
ggcgaccgcgtattatgggtaactgatatgggctggatgatgggaccatttttactattt
ggctctctcattaatggagcaacgatggttatgtacgaaggtgttccggatttcccaaaa
gcagatcgtttatgggagacagttgataaatatgaaattacacatcttggtatatcacca
acattaattcgtgcgttaatggcaaaaggtgatgagtatgtaaataaacattcgcttaag
agtttagaagtatttgcctcaacaggcgagccttggaatccagatccttggatgtggcta
tttgaaacagttggaaaaagtaatgtgccaatttgtaactattcgggcggaactgaaatt
tctggtgggattttcggaaatgtccttattaaaccaattgcaccgataagctttaacgct
tctttaccaggaatggcagcggttgtgctcgatgatcaaggtaatccaattcgtgatgaa
gttggagaattatgtttagagaaaccttgggttggtatgacgaaaagtttctgggaagac
gatgagcgttatgtgaacacatattggtcacgttttgaaaataaatgggttcacggtgac
tgggtggtttatgatggtgagcaatatattattacagggcgctcagatgatacgctaaac
attgctggaaaacgcattggacctgctgaatatgaatctattcttgtgaagcataatgat
gtcatagaagctgccgcgattggtgtaccagatgatgtaaaaggtgaagtttgtcattgt
tttgtagtattaagagataatgtaacatttacaggagaattaaagaaagaattaatgagt
ttagtaaactctcatattggaaaagcattatgtccaaaagatattcacgttgtagaagat
ttaccgaaaacacgtaattctaaagtaatgcgacgcgtcattaaagctgcttatttaggg
aaagaactaggtgatttatcatcacttgtaaaccctgaagtagtgccatttattcaggga
ttgcagtctagtaaattataa

DBGET integrated database retrieval system