KEGG   Bacillus anthracis H9401: H9401_2467Help
Entry
H9401_2467        CDS       T02028                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bax  Bacillus anthracis H9401
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    H9401_2467
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    H9401_2467
Enzymes [BR:bax01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     H9401_2467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2403881..2405032
Genome map
AA seq 383 aa AA seqDB search
MNVKITGLEMDSRKITNGNLFICVSGIDGFLEDRHQFVEDAVKNGAVALIVERDVNIEIP
KIIVKDARYAMAVIASHFYGYPSNKMKLIGITGTNGKTTTSYLLEKILSDYGYHTGLMGN
NGVKVGSKWYPTDINTQEPPTLQRNLQMMKNQNADYCVMEVTSQGLHMERVKGCNFKIAV
FTNLTQDHLDYHGTFDEYKHVKSLLFARLGNNLSTIDKKIAVLNADDPSVEYFKKITSAE
VITYGIHNGADVQAKNITLSPKGIRFLVSSFNGEIEVSLNLVGRFNVYNALAAITVALVE
GIPLTNISDSLSNLKSIEGRMEIIDENQDFLVIVDYAHTPDALENVLSTIREFAKGKIIT
VFGCGGDRDAKKTIYNGWNCWKL
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaaaaattacgggattagaaatggattctagaaagataactaatggtaaccta
tttatatgtgtatcaggtatcgatggttttcttgaagatcgacatcaatttgttgaagat
gcagtgaaaaatggtgctgtagcgctaattgtagaaagagatgtaaatattgagatacct
aaaataattgttaaagatgctaggtatgctatggcagttattgcgtcacatttctatggt
tatccatctaataaaatgaagttaattggaattacagggacaaatgggaaaacaactact
tcctatttacttgaaaaaattttaagtgattatggatatcacacggggctcatggggaat
aacggagtgaaagtgggttcaaaatggtatcctactgatattaatacgcaagaacctcca
acacttcaacggaatttgcaaatgatgaaaaatcaaaatgcagattattgtgttatggaa
gttacgtcacaagggttacatatggaaagagttaaagggtgtaactttaaaatagctgtt
ttcacaaatttaacacaagatcatttagattatcatggaacatttgatgaatataagcat
gtaaaaagtcttctttttgcgagattaggaaataatttatctactatagataaaaaaata
gctgttttgaatgcagacgatccatcggtagaatactttaaaaaaattacttcagctgag
gttatcacatatggaatacataatggagcagatgttcaagcgaagaacataactttaagt
ccaaaaggaattcgttttttagtttcgtcctttaatggcgaaatagaggttagccttaat
cttgtaggtcgttttaatgtttataatgcattagcagcaataacagttgcattggttgaa
ggtattccgcttacaaacattagtgatagcttatctaacttaaagagtattgaaggtaga
atggaaatcatagatgaaaatcaagatttccttgtaatagtggactatgctcatacaccg
gatgcgttagaaaatgttctctctacaattagagagtttgcaaaaggtaaaattattact
gttttcggttgtggtggagatagagacgcaaaaaaaacgatctataatgggtggaattgc
tggaagttatag

DBGET integrated database retrieval system