KEGG   Bacillus anthracis H9401: H9401_3072Help
Entry
H9401_3072        CDS       T02028                                 

Definition
NADPH-cytochrome P450 reductase
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bax  Bacillus anthracis H9401
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bax00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bax00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bax00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2956153..2959374)
Genome map
AA seq 1073 aa AA seqDB search
MLFERVFVMDKKVSAIPQPKTYGPLGNLPLIDKDKPTLSFIKLAEEYGPIFRMQTLSDTI
IVVSGHELVAEVCDETRFDKSIEGALAKVRAFAGDGLFTSETQEPNWQKAHNILMPTFSQ
RAMKDYHAMMVDIAVQLVQKWARLNPNENVDVPEDMTRLTLDTIGLCGFNYRFNSFYRET
PHPFITSMTRALDEAMHQLQRLDIEDKLMWRTKRQFQHDIQSMFSLVDNIIAERKSSENQ
EENDLLSRMLNVQDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKNPDKLK
KAYEEVDRVLTDSTPTYQQVMKLKYIRMILNESLRLWPTAPAFSLYAKEDTVIGGKYPIK
KGEDRISVLIPQLHRDKDAWGDNVEEFQPERFEELDKVPHHAYKPFGNGQRACIGMQFAL
HEATLVMGMLLQHFEFIDYEEYQLDVKQTLTLKPGDFKIRIVPRNQTISHTTVLAPTEEK
LKNHEIKQQVQKTPSIIGADNLSLLVLYGSDTGVAEGIARELADTASLEGVQTEVAALND
RIGSLPKEGAVLIVTSSYNGKPPSNAGQFVQWLEELKGDELKGVQYAVFGCGDHNWASTY
QRIPRYIDEQMAQKGATRFSTRGEADASGDFEEQLEQWKQRMWSDAMKVFGLELNKNMEK
ERSTLSLQFVSRLGGSPLARTYEAVYASILENRELQSSSSERSTRHIEISLPEGATYKEG
DHLGVLPINSEKNVNRILKRFGLNGKDQVILSASGRSVNHIPLDSPVRLYDLLSYSVEVQ
EAATRAQIREMVTFTACPPHKKELESLLEDGVYQEQILKKRISMLDLLEKYEACEIRFEP
FLELLPALKPRYYSISSSPLVAQDRLSITVGVVNAPAWSGEGTYEGVASNYLAQRHNKDE
IICFIRTPQSNFQLPENPETPIIMVGPGTGIAPFRGFLQARRVQKQKGMNVGEAHLYFGC
RHPEKDYLYRTELENDERDGLISLHTAFSRLEGQAKTYVQHVIKEDRIHLISLLDNGAHL
YICGDGSKMAPDVEDTLCQAYQEIHEVSEQEARNWLDRLQEEGRYGKDVWAGI
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atgctttttgaaagggtgtttgtaatggataaaaaagtatctgccattcctcaaccgaaa
acatatggaccgctggggaatctcccattaatcgataaagataaaccgactctatcgttt
attaagctggcggaagagtatggtcccatttttcggatgcaaactttaagtgataccatc
attgtcgtttctggacatgaactggtagcagaagtctgtgacgaaacacggttcgataaa
agtatagagggtgctttagcaaaggttcgtgcttttgctggagatggattatttacaagc
gagactcaagagcctaactggcaaaaagctcataatattttgatgcctacattcagccaa
agagcaatgaaagattaccatgctatgatggtcgatattgccgtacaactcgttcaaaaa
tgggcaagactgaatccgaatgaaaacgtagatgttccggaagatatgactcgccttaca
ttagatacaattggtctatgtggttttaattatcgatttaatagcttttatcgtgagacc
cctcatccttttattactagtatgacccgtgcgttagatgaggcgatgcaccaattacag
cggctggatatagaagacaaactcatgtggagaacgaaacgtcaatttcagcatgatatt
caatctatgttttcattagtagataatattattgctgaacgtaaaagtagtgaaaatcag
gaagaaaatgatttgctttcccgtatgttaaatgtgcaggatccagaaactggtgaaaaa
ttagatgatgaaaatattcgtttccaaattattacctttttaatagctgggcatgagaca
acaagtggattgttatcttttgcaatctattttttattaaagaatccggataaattgaaa
aaagcctatgaagaagtagatcgggttttgacagattctactccaacataccaacaagtt
atgaaattaaagtatatacggatgattttaaatgaatcactacgtctatggcctactgct
ccagcatttagtctctatgcaaaagaagatacagtaattggtggaaaatacccaattaag
aaaggcgaagatcgtatttctgttctgattccacagctacatagggataaagacgcgtgg
ggagacaatgtggaagaatttcaacctgaacgatttgaagagctggataaggttcctcat
catgcttataagccatttggaaatggtcagcgagcatgtatcggtatgcagtttgcactt
catgaagcaacactcgtgatgggaatgcttcttcaacattttgaattcatcgattatgaa
gaatatcagctggacgtaaaacaaacattaacgctaaagcctggtgattttaaaattagg
attgtaccccgaaatcaaactattagccatactactgttcttgcgcctacagaggagaaa
ctaaaaaaccatgaaattaagcagcaagttcagaaaactccttccattattggagccgat
aatctttcacttcttgttctgtatggctcagatacaggggtagcagaaggtattgcaaga
gaactagcagatacagctagtttagaaggtgttcaaacggaagtggcagctcttaacgat
cgaattggaagtttgccaaaagaaggagcggttcttattgtaacttcttcttataatgga
aagccgccaagtaatgcagggcagtttgtgcagtggctggaggaattaaaaggggatgag
ctaaaaggtgttcaatacgcagtttttggttgtggagaccataattgggctagtacctat
cagcgaattccaagatacattgatgagcaaatggcgcaaaaaggagcaacaagattttct
acacgtggagaagcggatgcaagtggtgatttcgaggaacagctcgagcaatggaaacaa
agaatgtggtctgatgcgatgaaggtatttggattggaacttaacaaaaacatggagaaa
gaacgcagtacattaagtttacaatttgtcagtcgtcttggaggatctcctcttgcgcga
acatatgaagcagtttatgcatctatactagaaaatcgtgaacttcaatcatctagcagt
gaaagaagcacgcgacatattgaaatatctttgccagaaggcgctacatataaagaagga
gaccatcttggggtactgccaattaatagcgagaaaaatgtcaaccgaattttaaaacgc
tttggattaaacgggaaggatcaagtcatactgagtgcaagtggacgaagtgtaaatcac
atacctttagacagtcctgttcgtttatatgaccttcttagttatagtgttgaagtgcaa
gaagcagccactcgagcacaaatacgagaaatggtgacattcacagcatgccctcctcat
aaaaaggaattggaatcattattggaagacggagtttatcaagaacaaatattaaagaaa
cgtatttcaatgttggatcttcttgaaaagtatgaggcttgtgaaattcgatttgaaccc
tttttagaacttcttcctgcgctcaaaccgcgttactattcaatttcaagctctccactc
gttgcacaggatcgtctgagcattacggttggtgttgtgaatgcgcctgcatggagcggg
gaagggacatatgaaggagtcgcttctaattatttagctcagcgtcataataaagatgag
attatctgtttcattcgaacgccacaatcaaactttcaattacctgaaaatccagaaaca
ccaattattatggttggaccaggcactggaattgcaccattccgtggatttttacaagca
cgacgtgttcaaaagcaaaaaggtatgaacgtaggagaagcacatctatactttggttgt
cgtcatcctgaaaaggattatctttatcgtacagaactagagaatgatgaaagagatgga
ttaatctctttacacacagctttttctcgcttagaaggacaagctaaaacatatgtacag
catgtaataaaagaagatagaatccatttaatttcgttattagataatggagctcatctt
tacatatgtggtgatggaagtaaaatggctcctgacgtagaagataccctttgtcaagca
tatcaagaaattcatgaagtcagtgaacaagaagcaaggaattggttggaccgtctgcaa
gaggaaggacgatatggaaaagatgtttgggctggtatataa

DBGET integrated database retrieval system