KEGG   Bacillus anthracis H9401: H9401_3243Help
Entry
H9401_3243        CDS       T02028                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase 1
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bax  Bacillus anthracis H9401
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:bax00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3124233..3125390
Genome map
AA seq 385 aa AA seqDB search
MVKYISILGSTGSIGTSALDVVSAHPEHFKIVGLTANYNIELLEQQIKTFQPRIVSVATK
ELADTLRTRISTNTKITYGTDGLIAVATHPNSNLVLSSVVGVSGLLPTIEALKAKKDIAI
ANKETLVAAGHIVTELAKQNGCRLIPVDSEHSAIFQCLNGENNKEIDKLIVTASGGAFRD
KTREEMKTLQAKDALKHPNWLMGAKLTIDSATLMNKGFEVMEARWLFDIPYEKINVMIHK
ESIIHSLVEFIDGSVIAQLGAPDMRMPIQYAFHYPTRLPSSYEKLNLLEIGSLHFEKPDL
EKFPCLQYAYECGKIGGITPAVLNAANEIANALFLKNEIAFFDIEKTIYKTVEAHHNVKD
PSLDAILEADQWARQYANQLLIKKS
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaatatatatccattttaggttcaacaggatccatcggcacatcggcattagat
gtcgtttcagctcatcccgaacattttaaaatcgtcggtttaaccgcaaattataatatc
gagcttcttgaacaacaaatcaaaacgtttcaacctcgcattgtaagcgtcgcgacaaaa
gaattagcagacacgcttcgtacgcgtatttcaaccaacacaaaaatcacatacggaaca
gatggcttaattgcagtagctactcaccctaattcaaatcttgtattaagttccgtcgtt
ggtgtttcaggattactcccaacaattgaagcattaaaagcgaagaaagatattgccatc
gctaataaagaaacgttagttgcagctggtcatattgtaactgaactggccaaacaaaac
ggatgtcgtttaattccagtcgatagcgaacattcagctattttccaatgtttaaacgga
gaaaataataaagaaattgacaaattaatcgttacagcttctggcggtgcattccgtgat
aaaacacgtgaagaaatgaaaactctacaagcaaaagatgctttaaagcacccaaactgg
ttaatgggggcaaaactaacgattgattctgccacgttaatgaataaaggatttgaagta
atggaagcgagatggttatttgatattccttatgaaaaaattaatgtaatgattcataaa
gaaagcattattcattctttagtagagtttatcgatggatcagttatagcacagctcggt
gctcctgatatgaggatgccgattcaatatgcgtttcactaccctactcggctgccttct
tcctatgaaaaattaaatttattagaaatcggtagtttacattttgaaaaaccagattta
gagaagtttccttgtctacaatacgcatatgaatgtggcaaaattggtggtattactcct
gctgtattaaacgcagcaaatgaaattgcgaatgcactattcttaaaaaatgaaattgcc
tttttcgatattgaaaaaacaatttacaaaacagttgaagcccatcataacgtaaaagat
ccttcactagatgctatattagaagcggatcaatgggcacgccaatatgcaaatcaattg
ttaataaaaaagagctaa

DBGET integrated database retrieval system