KEGG   Bacillus anthracis H9401: H9401_3770Help
Entry
H9401_3770        CDS       T02028                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase 2
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00900  Terpenoid backbone biosynthesis
bax01100  Metabolic pathways
bax01110  Biosynthesis of secondary metabolites
bax01130  Biosynthesis of antibiotics
Module
bax_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    H9401_3770
Enzymes [BR:bax01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     H9401_3770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_redisom_C DXP_reductoisom Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFH85156
Position
complement(3627337..3628503)
Genome map
AA seq 388 aa AA seqDB search
MNERGVGIMKNISLLGASGSIGTQTLDVLRSHPDQFRLVAFSVGKNIDYAVKVIQEFSPQ
IVSVQREEDVLKLQAVSGNTKIVYGSEGLLEVALHPDAEIVVNAVVGSVGLLPTLRAIEA
KKTIGIANKETLVTAGHLVMEAARKHNVSLLPVDSEHSAIFQCLNGENEKRISRLIITAS
GGSFRDKTRDELHHVTVEDALRHPNWSMGSKITIDSATMMNKGLEVIEAHWLFGIPYEQI
DVVLHKESIIHSMVEFEDRSVMAQLGSPDMRVPIQYALTYPDRLPLSDTKQLNLWEIGTL
HFEKMNQERFRCLRFAYEAGKAGGSMPAVMNAANEVAVEAFLQKRIGFLTVEDLIEKAMN
HHNVIARPSLEEILEIDAATRRFVMEQI
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaacgaggggttggaatcatgaaaaacattagtttattaggtgcaagcggatca
attggtacacaaactttagatgtattacgctcgcacccagaccaattccgtctcgttgct
ttttctgtagggaaaaatattgactacgcagtaaaggtcattcaagaattttctccacaa
attgtctctgtgcaaagagaggaagatgttttaaaattacaagctgtttctggtaataca
aaaattgtatatggtagtgaagggcttttagaagtagcattacatccagatgcggagatt
gtagtaaacgctgttgtaggtagcgtagggttgttaccaacacttcgtgcaattgaggcg
aaaaaaacaattggaattgcaaacaaagaaacgttagtaactgcagggcatcttgtaatg
gaagcagcgcgaaaacataatgtttcgttacttccagtagacagtgaacattcagctatt
tttcaatgcttgaatggtgaaaatgaaaaaagaatttctcgactaattataacggcttct
ggtggaagtttccgtgataaaacgagagatgaattgcatcatgtgaccgtagaagatgcg
cttcgacatccaaactggtcaatgggttcgaaaattacaattgattctgctacaatgatg
aataaggggctagaagtaattgaagcacattggctttttggtatcccttatgagcaaatc
gatgttgttttacataaagaaagtattattcattctatggttgaatttgaagatcgtagt
gtgatggcacagcttggctcacctgatatgcgagtaccaattcaatacgcgcttacatat
cctgatcgattacctctttcagacacaaagcagttaaacttatgggaaataggaacgttg
cattttgagaagatgaaccaagaacgtttccgttgcctacgttttgcgtatgaagctgga
aaagcaggtggaagtatgccagctgtaatgaatgcagcgaatgaagtagctgttgaagct
tttttacaaaagagaattggtttcttaacagtggaagacctcattgaaaaagcaatgaac
catcacaatgtcattgcacgtccgagcttagaggaaattctggaaattgatgcagccaca
agacggtttgtgatggaacaaatttag

DBGET integrated database retrieval system