KEGG   Bacillus anthracis H9401: H9401_3839Help
Entry
H9401_3839        CDS       T02028                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bax  Bacillus anthracis H9401
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    H9401_3839
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    H9401_3839
Enzymes [BR:bax01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     H9401_3839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3698505..3699425)
Genome map
AA seq 306 aa AA seqDB search
MTMSHLLTMSELSEVEISEILKDAEDFANGKESKTTEQTFVANLFFENSTRTRFSFEVAE
KRLGLDVLNFSADASSVQKGETLYDTIRTLESIGTKAVVIRHEQDRYFDELKDQVNIPIL
NAGDGCGNHPTQCLLDLLTIKQEFGRFEGLKIAIVGDVRHSRVARSNAEALTKLGATIYF
ASPEEWKDEDNTFGTYKPLDELVPEVDVMMLLRVQHERHDHYETDIMKEYHEKHGLTVER
EKRMKEGSIIMHPAPVNRDVEIASELVECERSRIFKQMENGVYVRMAVLKRALPNVLGGM
KHELFV
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgagccatttgttaacgatgagtgaattatcggaagtagaaatttcagaaatc
ctaaaagacgcagaagattttgcgaatgggaaagagagcaaaacgacagagcaaactttt
gttgcaaacttgttctttgagaatagtacgagaacgagatttagctttgaagttgctgag
aagagattaggacttgatgttttaaacttttcagctgatgcatctagcgtacaaaaagga
gaaactttatacgatacgataagaacactagaatcaatcggaacaaaagcagtggtcatc
cgccatgagcaagatcgctacttcgatgaactaaaagatcaggtgaatattccaatctta
aacgctggagatggatgtggaaatcatccaacacagtgcctgctcgatcttcttaccatt
aaacaagagtttggaagatttgaaggtttgaagattgcgatagtaggagatgttcgtcat
agccgagtagcacgttctaatgcagaagcattaacgaagctgggtgcaacaatttatttt
gcaagtccagaagagtggaaagatgaagacaacacatttggaacatacaaaccattagat
gaacttgttccggaagtggacgtaatgatgttacttcgtgtacaacatgagcgtcatgat
cattatgaaacagacattatgaaagagtatcatgagaaacacggattaacagtggaaaga
gaaaagcgtatgaaagaaggaagcattattatgcatccagctcctgtaaaccgagatgtt
gaaattgcaagtgaacttgttgagtgtgagcgttcacgcatatttaaacaaatggaaaat
ggagtttacgtaagaatggctgtactaaaacgcgccttaccaaatgtattaggaggaatg
aaacatgaattatttgtttaa

DBGET integrated database retrieval system