KEGG   Bacillus anthracis H9401: H9401_4049Help
Entry
H9401_4049        CDS       T02028                                 

Definition
Oxidoreductase, short-chain dehydrogenase/reductase family
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
bax  Bacillus anthracis H9401
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    H9401_4049
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    H9401_4049
Enzymes [BR:bax01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     H9401_4049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3877491..3878279
Genome map
AA seq 262 aa AA seqDB search
MFFIMVTNRVVFLTGAASGIGYEMGNTFAKEGAKVVITDRLEERAKEAAEQLQKEGFQAI
GLKCDVTSEEEIEASISQTVNHFGSLDILINNAGMQHVSPIEDFPTEKFELLIKIMQIAP
FIAIKHAFPIMKKQKYGRIINVASINGLVGFAGKAAYNSAKHGVIGLTKVAALEGATHGI
TVNALCPGYVDTPLVRNQLQDLATTRNVPLENVLEDVIYPLVPQKRLLQVQEIADYAMFL
ASEKAKGITGQAVVIDGGYTAQ
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcatcatggttacaaatcgagttgtttttttaacaggtgctgcaagtggtatt
ggatatgaaatgggaaacacttttgcaaaagaaggtgcaaaagttgttattaccgatcgt
cttgaagaacgtgcaaaagaagctgctgaacaactacaaaaagagggctttcaagctatc
ggcttaaaatgtgatgttacatccgaagaagaaatagaagcatccatttcccaaactgtt
aatcatttcggttcattagacatattaattaataacgcaggaatgcaacacgtttcacca
attgaagatttcccaaccgaaaaattcgagctactaattaaaattatgcaaatcgctcct
tttatcgccattaagcatgcctttcccattatgaaaaagcaaaaatatggccgaattatt
aatgtagcttccattaatggcctcgttggattcgctggaaaagctgcttataatagcgca
aaacatggcgtaattggattaacaaaagttgccgctttagaaggggctactcacggaatt
actgttaatgcactttgtcccggttatgtcgatacccctctcgtacggaatcaattacaa
gacttggccaccacacgaaatgtaccacttgaaaatgttttagaggatgtcatttatcca
cttgtcccacaaaaacgcttattacaagtacaagagattgctgattatgcgatgttttta
gcgagcgaaaaagcgaaaggtataactggacaagctgtcgttatcgatggtggttatacc
gctcaataa

DBGET integrated database retrieval system