KEGG   Bacillus anthracis H9401: H9401_4058Help
Entry
H9401_4058        CDS       T02028                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
bax  Bacillus anthracis H9401
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    H9401_4058
Enzymes [BR:bax01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     H9401_4058
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     H9401_4058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3885889..3886401
Genome map
AA seq 170 aa AA seqDB search
MAQIRIHEVNTRIENEVKVSKFLQEEGVLYEKWNISKLPPHLNENYSLTDENKAEILAVF
SKEIADVSARRGYKAHDVISLSNSTPNLDELLINFQKEHHHTDDEVRFIVSGHGIFAIEG
KDGTFFDVELEPGDLISVPENARHYFTLQDDRQVVAIRIFVTTEGWVPIY
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattcgtattcatgaagtaaatactcgcattgaaaatgaagtgaaagtatct
aaatttctacaagaggaaggtgttttatatgagaaatggaatatttctaaacttcctcct
catttaaatgaaaattattcgttaacagatgaaaacaaggctgaaatattagctgtgttt
tcaaaagaaattgctgatgtttcagcgcgccgaggttataaagcacatgatgtaatttca
ctttcaaatagcacacctaatcttgacgaactattaattaatttccaaaaagaacaccat
catactgatgatgaagttcgctttattgttagtggtcatggcatctttgccattgaagga
aaagatgggacattctttgacgttgaacttgagccaggcgatctcatatctgttcctgaa
aatgcaagacattattttaccttgcaagatgatcgtcaagttgtagctattcgtattttt
gttacaactgaaggttgggttccaatctattaa

DBGET integrated database retrieval system