KEGG   Bacillus anthracis H9401: H9401_4363Help
Entry
H9401_4363        CDS       T02028                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bax  Bacillus anthracis H9401
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    H9401_4363
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    H9401_4363
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    H9401_4363
Enzymes [BR:bax01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     H9401_4363
Exosome [BR:bax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H9401_4363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4146001..4147386)
Genome map
AA seq 461 aa AA seqDB search
MKKFVKKAWPFAVVASLAVTSVATWNFTRSSEVSADENGSNAKIKNVIVLIGDGMGPSYM
TAHRYMKDNPKTFEMESTEFDKHLVGTQKTYPEDEHENITDSASAATAMSAGIKTYNAAI
AVDNDKAEVKTVLEQAKEKGKSTGLVATSEITHATPAAFGAHDISRKSMDAIANDYFDEK
IKGKHKVDVMLGGGVKNFVRKDRNLTEEFKKSGYSYVTDRDQLLNDKNDQILGLFAPGGL
DKMIDRNEKTPSLEEMTNAAIERLNKNKKGFFLMVEGSQIDWAGHDNDIVGAMSEMEDFE
KAFKAAIEFAKKDKNTLVIATADHATGGLSLGANGEYNFKVDPIKAAKRTPDFMANEIVK
GANVEETLKKYIDLQLTPEEIKAVNDIAPSKDVTKIDNAIEDIFNKRSVTGWTTGGHTGE
DVNVYAFGPGKYLFSGVQENTNLAKRVFDIVGGGDPNKGRR
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagtttgtgaaaaaagcatggccatttgcagttgtggcatcattagcagttact
tcggtagcaacatggaattttacacgttctagtgaagtgagcgcagatgagaacggaagc
aatgcaaagattaaaaatgttattgtgttaattggagatggtatgggcccttcatatatg
acagctcaccgttatatgaaagataatccaaaaacattcgagatggaatctacagagttt
gataaacatcttgtaggaacacaaaaaacatatccggaagatgaacatgaaaatatcaca
gactcagcatcagcagcaacagctatgtcagcaggaattaaaacatataatgcggcaatt
gcagttgataatgataaagcagaagtgaaaactgttcttgagcaagcgaaagagaaaggg
aaatcaacaggattagttgctacttctgaaattacacatgcaacaccagctgctttcggt
gcgcatgacattagtcgtaaaagtatggacgcaattgcaaatgattattttgatgagaaa
attaaagggaagcataaagtagatgttatgcttggcggcggcgtaaaaaactttgttaga
aaagatcgcaatcttacagaagaatttaagaaatctggttatagttacgtaacagatcga
gatcaattgttaaatgataaaaatgatcaaattcttggtttatttgcaccaggcggttta
gataaaatgattgaccgcaatgagaagacaccttcattagaagaaatgacaaatgcagca
attgagcgtttgaacaaaaataaaaaaggtttcttcttaatggttgaaggaagccaaatt
gactgggcaggacacgataatgatatcgttggtgcaatgagtgagatggaagactttgaa
aaagcatttaaagctgcgattgagtttgcgaaaaaagataaaaatacgttagtcattgca
acggcagatcacgctactggcgggttatctttaggtgcgaatggtgagtacaactttaaa
gtagatccaattaaagctgcaaaacgcacaccggacttcatggcaaatgaaattgtaaaa
ggtgcaaatgtagaagaaacattgaaaaaatatattgatttacaattaacacctgaagaa
attaaagcggtaaatgatatcgctccttcaaaagatgtaacaaagattgataatgcgatt
gaagatattttcaataagcgttcggttacaggatggacaacaggtggacatacaggagaa
gatgtaaacgtatatgcatttggccctggtaaatacttgttctctggcgttcaagagaat
acaaatctcgctaaacgtgtctttgatattgttggcggtggtgatccgaataaaggaaga
cgctaa

DBGET integrated database retrieval system