KEGG   Bacillus anthracis H9401: H9401_4481Help
Entry
H9401_4481        CDS       T02028                                 

Definition
Delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bax  Bacillus anthracis H9401
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    H9401_4481
Enzymes [BR:bax01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     H9401_4481
Exosome [BR:bax04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   H9401_4481
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4260279..4261268)
Genome map
AA seq 329 aa AA seqDB search
MNSLQFNRHRRLRQSGGMRALVRETFLHTEDFIYPIFVLEGENVRNEVPSMPGVYQMSLD
LLQAEMQEVVDLGIRSVIVFGLPAEKDEVGSSAYCDHGIVQRAIQQIKGEFPDLVVVADT
CLCQFTSHGHCGVIEDGIILNDESLAVLAKTAVSQAKAGADIIAPSNMMDGFVTAIRHAL
DENGFGHVPVMSYAVKYSSAFYGPFRDAAHGAPQFGDRKTYQMDPANRMEAFREAESDVM
EGADFLIVKPALSYLDIVRDVKNNFNLPVVAYNVSGEYSMIKAAAQNGWINEKEVVLEKL
ISMKRAGADLIITYHAKDAARWLQEGGAK
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgaactctttacaatttaatcgtcatcgtcgcttaagacaaagcgggggcatgcgtgcg
cttgtgcgtgaaacgtttttacatacggaagattttatttaccctatttttgtattagaa
ggtgaaaatgttcgtaatgaagtaccttctatgccaggcgtatatcaaatgtctttagat
ttattgcaagctgaaatgcaagaagttgttgatttaggtattcgttctgttattgtattt
ggtttacctgctgaaaaagatgaagttggatcatcagcatattgtgatcatggaattgtg
caacgcgcgattcagcaaattaaaggtgaattccccgatctagtagtagttgcggataca
tgtttatgtcaatttacaagccatggtcattgcggtgtaattgaagatggtattatttta
aatgacgagtctcttgcagttcttgcaaaaacagctgtaagccaagcgaaagcaggagcg
gacattattgcgccatcaaacatgatggacggattcgtaacagcaattcgccacgcatta
gatgaaaatggttttggacatgtaccagttatgtcgtacgctgtgaaatattcatcagca
ttttatggaccattccgtgatgcggcacacggtgcaccgcaatttggtgatcgtaaaaca
tatcaaatggacccagcgaaccgcatggaagcattccgtgaagcagaatcagatgtaatg
gaaggggcagatttcttaattgtaaaaccagctctttcttatttagatatcgttcgtgat
gtgaaaaataactttaatttaccagtcgttgcttataacgtaagcggtgaatattcaatg
attaaagcggcagcgcaaaatggttggattaatgaaaaagaagttgtacttgaaaaatta
attagtatgaaacgtgcaggagcagatttaattattacgtatcatgcaaaagatgcagca
agatggttacaagaaggaggcgctaaataa

DBGET integrated database retrieval system