KEGG   Bacillus anthracis H9401: H9401_4544Help
Entry
H9401_4544        CDS       T02028                                 

Definition
Short chain enoyl-CoA hydratase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bax  Bacillus anthracis H9401
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    H9401_4544
  Lipid metabolism
   00071 Fatty acid degradation
    H9401_4544
Enzymes [BR:bax01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     H9401_4544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(4319064..4319852)
Genome map
AA seq 262 aa AA seqDB search
MGGIMLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEG
RFFSAGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMS
CHMRFATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGL
VNGVFAEETFLDDTLKVAKQIAGKSPATARAVLELLQTTKSSHYYEGVQREAQIFGEVFT
SEDGREGVAAFLEKRKPSFSGR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggagggatcatgttgaaattcctatctgtaagagttgaagatcatatcgcggtggct
acgttaaatcatgcgccagctaacgcgatgtcttcgcaagttatgcatgacgttactgaa
ttaattgatcaagtggagaaggatgataatattcgtgttgttgttattcatggtgaaggg
cgcttcttctcggcgggagcagatattaaagaatttacatctgttactgaagcgaagcaa
gcgactgaattagcgcagcttggacaagttacgtttgagcgcgttgaaaaatgttcaaaa
ccagttatcgcggcaattcatggagcggcacttggcggcggccttgagtttgctatgtct
tgccacatgcgctttgcaactgaaagcgcaaaacttggtttacctgaattaacacttgga
ttaattcctggatttgcaggtacacagcgattaccacgttatgttgggaaagcgaaagct
tgtgaaatgatgttaacaagtacaccgattactggtgcagaagcattaaaatggggacta
gttaacggagtttttgctgaagaaacatttttagatgatacgcttaaagttgcaaaacag
attgctggaaaaagcccagcgacggcccgtgctgtactagagttattgcaaacgacgaaa
tcgtctcattattatgagggtgtacaacgcgaagctcaaatctttggtgaagtatttacg
agtgaagatggaagagaaggtgtagcagcatttttagaaaagcgtaagccttcatttagt
ggcaggtag

DBGET integrated database retrieval system