KEGG   Bacillus anthracis H9401: H9401_4609Help
Entry
H9401_4609        CDS       T02028                                 

Definition
Formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bax  Bacillus anthracis H9401
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bax03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4381985..4382815)
Genome map
AA seq 276 aa AA seqDB search
MPELPEVENVRRTLENLVTGKTIEDVIVTYPKIVKRPDDAEIFKEMLKGETIENIKRRGK
FLLLYVTNYVIVSHLRMEGKFLLHQEDEPIDKHTHVRFLFTDGTELHYKDVRKFGTMHLF
KKGEEMNQMPLADLGPEPFDAELTPQYLHERLQKTNRKIKVVLLDQRLLVGLGNIYVDEV
LFRSQIHPEREASSLTAEEIERIYEATVTTLGEAVKRGGSTIRTYINSQGQIGSFQELLN
VYGKKGEPCVTCGTILEKTVVGGRGTHYCPICQPRI
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattaccagaggttgaaaacgtcagacggacacttgaaaatcttgtaacagga
aaaacaattgaagacgtcattgttacctatcccaaaatagtaaaacgcccagatgatgca
gaaatctttaaagaaatgctaaaaggcgagacgattgaaaatataaagcgaagaggaaag
tttttgcttttatatgtaacgaattatgttattgtttcacatttgcgtatggaaggtaag
tttttactgcatcaagaggatgaaccaattgataagcatacgcacgtccgtttcttgttt
acagatggaactgaattacattataaagatgtgagaaagttcggtacgatgcatctcttt
aaaaaaggtgaggaaatgaatcaaatgcctctagctgacttaggtccagagccatttgat
gctgaattgacaccacagtatttacatgagagattgcaaaagacaaatcggaaaataaaa
gttgtattgttagaccagcgtcttttagtaggacttggaaatatatatgtagatgaagtt
ttattccgttctcaaattcacccagaacgagaagcgtcttctttaacagcggaagaaatt
gagcggatttatgaggcgactgttacaacgttaggcgaagccgtgaaacgtggcggaagt
acgattcgaacgtatatcaactcacaagggcaaattggctcattccaagaacttctaaat
gtatatggaaaaaaaggagaaccgtgtgtgacttgcggtacgatattagaaaaaacagtt
gttggcggaagaggaacgcattactgcccgatttgtcagcctagaatatag

DBGET integrated database retrieval system