KEGG   Bacillus anthracis H9401: H9401_4787Help
Entry
H9401_4787        CDS       T02028                                 

Definition
Lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bax  Bacillus anthracis H9401
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:bax00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4538307..4539152)
Genome map
AA seq 281 aa AA seqDB search
MYQIMKKSEMEESRMWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLP
SHGTTSRNRGHIDSFDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDV
DGIILSSPCLGVLAGPSAPLQAASKILNIIAPKLQFATNLTVEMSTRNHEVRDAMENDSL
FLRKVSVRWYSELIKSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFNNVKISDK
AFKEWPNCYHELLNEYERDEILNYIQSFTEIRINNIIETNK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgtaccaaattatgaaaaagagtgaaatggaggagagccgtatgtggaattatgaagct
gaagaagcaaaggctgtaatcgttatcgtgcacggcgcaatggaatatcacggacgctat
gaagccgttgcggaaatgtggaatcatatcggctaccatgtcgtgatgggggaccttccg
tcacatggaacgacttcaagaaatagaggacatattgattcgtttgatgaatacatagag
gaagttaaattatgggtgaaagaggcaagaaagtatcggttacctatttttctatttggt
catagtatgggtggtcttattgtcattcgtatgatgcaagaaacgaagagagaagatgta
gacggcattattttaagttcgccatgtttaggtgtattagctggaccttctgcaccgctt
caagctgcctcaaaaatattaaatattatcgctccgaagttacaatttgcaacgaatctt
acagtggaaatgtcaacgcgtaatcatgaagtgagagatgcgatggagaacgattcattg
ttcttgcgcaaagtatcagtacgttggtatagtgaattgattaagtctattgaaatcgct
cataaaaaaatagatgattttccagatgttccgctcttgctaatgcaagcatgtgaggat
aaacttgtagataaaacacgtgtccgcacttggtttaataatgttaaaataagtgataag
gcttttaaagaatggccgaattgttatcatgagttattaaatgagtatgagcgtgatgaa
attttgaattatattcagtcatttactgaaatacgcatcaataacataatagaaacaaat
aagtaa

DBGET integrated database retrieval system