KEGG   Bacillus anthracis H9401: H9401_4787Help
Entry
H9401_4787        CDS       T02028                                 

Definition
Lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bax  Bacillus anthracis H9401
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    H9401_4787
Enzymes [BR:bax01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     H9401_4787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4538307..4539152)
Genome map
AA seq 281 aa AA seqDB search
MYQIMKKSEMEESRMWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLP
SHGTTSRNRGHIDSFDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDV
DGIILSSPCLGVLAGPSAPLQAASKILNIIAPKLQFATNLTVEMSTRNHEVRDAMENDSL
FLRKVSVRWYSELIKSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFNNVKISDK
AFKEWPNCYHELLNEYERDEILNYIQSFTEIRINNIIETNK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgtaccaaattatgaaaaagagtgaaatggaggagagccgtatgtggaattatgaagct
gaagaagcaaaggctgtaatcgttatcgtgcacggcgcaatggaatatcacggacgctat
gaagccgttgcggaaatgtggaatcatatcggctaccatgtcgtgatgggggaccttccg
tcacatggaacgacttcaagaaatagaggacatattgattcgtttgatgaatacatagag
gaagttaaattatgggtgaaagaggcaagaaagtatcggttacctatttttctatttggt
catagtatgggtggtcttattgtcattcgtatgatgcaagaaacgaagagagaagatgta
gacggcattattttaagttcgccatgtttaggtgtattagctggaccttctgcaccgctt
caagctgcctcaaaaatattaaatattatcgctccgaagttacaatttgcaacgaatctt
acagtggaaatgtcaacgcgtaatcatgaagtgagagatgcgatggagaacgattcattg
ttcttgcgcaaagtatcagtacgttggtatagtgaattgattaagtctattgaaatcgct
cataaaaaaatagatgattttccagatgttccgctcttgctaatgcaagcatgtgaggat
aaacttgtagataaaacacgtgtccgcacttggtttaataatgttaaaataagtgataag
gcttttaaagaatggccgaattgttatcatgagttattaaatgagtatgagcgtgatgaa
attttgaattatattcagtcatttactgaaatacgcatcaataacataatagaaacaaat
aagtaa

DBGET integrated database retrieval system