KEGG   Bacillus anthracis H9401: H9401_4918Help
Entry
H9401_4918        CDS       T02028                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bax  Bacillus anthracis H9401
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    H9401_4918
   00052 Galactose metabolism
    H9401_4918
   00500 Starch and sucrose metabolism
    H9401_4918
   00520 Amino sugar and nucleotide sugar metabolism
    H9401_4918
Enzymes [BR:bax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     H9401_4918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4668531..4669421)
Genome map
AA seq 296 aa AA seqDB search
MMKRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGK
TKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARK
FIGDEPFAVLLGDDIVQAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQE
GRRYQVRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLEQQHVGAGGEIQLTDAIQSLNE
IQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVTMMKKILEEQTNQES
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaagagtaagaaaagcgataatcccagcagctggattaggaacacgtttttta
ccagctacaaaagcaatgccaaaagaaatgttaccgattgttgataaaccaactatccaa
tacattgtagaagaagcagtaaaatcaggaatcgaagatattattatcgttactggtaaa
acgaagcgttctattgaagatcattttgataatgcatttgagttagagcaaaacttatta
gaaaagaaaaagtatgagttacttgaaaaagtacaggcttcttcaaaaatggtagacatt
cactatatccgtcaaaaagaaccaaaaggattaggtcacgctgtttggtgtgcacgtaaa
ttcatcggtgatgagccatttgctgttttattaggtgatgatatcgttcaagctgaaaaa
ccatgtttacgtcaattaattgaagaatatgataaaacgctttcttctgttattggtgta
caaacggttccagaagacgaaacacaccgctacggaattattgatccgttagagcaagaa
ggacgtcgttaccaagttcgcaatttcgttgagaaaccagcagcaggtacagcaccttca
aacttagcaattatgggacgttacgttttaacacctgaaatcttcatgttcttagaacaa
caacatgttggtgctggtggtgaaatccagttaacagatgctattcaaagcttaaacgaa
attcaacgtgtattcgcttacgatttcgaaggaaagcgctacgacgtaggtgaaaagcta
ggattcgttcaaacgacaatcgaaatggcactgcaacacccagaattacgtgatgacatg
gttacgatgatgaagaaaattttagaagaacaaacgaatcaagagtcttaa

DBGET integrated database retrieval system