KEGG   Bacillus anthracis H9401: H9401_4918Help
Entry
H9401_4918        CDS       T02028                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bax  Bacillus anthracis H9401
Pathway
bax00040  Pentose and glucuronate interconversions
bax00052  Galactose metabolism
bax00500  Starch and sucrose metabolism
bax00520  Amino sugar and nucleotide sugar metabolism
bax01100  Metabolic pathways
bax01130  Biosynthesis of antibiotics
Module
bax_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bax00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    H9401_4918
   00052 Galactose metabolism
    H9401_4918
   00500 Starch and sucrose metabolism
    H9401_4918
   00520 Amino sugar and nucleotide sugar metabolism
    H9401_4918
Enzymes [BR:bax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     H9401_4918
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AFH86304
Position
complement(4668531..4669421)
Genome map
AA seq 296 aa AA seqDB search
MMKRVRKAIIPAAGLGTRFLPATKAMPKEMLPIVDKPTIQYIVEEAVKSGIEDIIIVTGK
TKRSIEDHFDNAFELEQNLLEKKKYELLEKVQASSKMVDIHYIRQKEPKGLGHAVWCARK
FIGDEPFAVLLGDDIVQAEKPCLRQLIEEYDKTLSSVIGVQTVPEDETHRYGIIDPLEQE
GRRYQVRNFVEKPAAGTAPSNLAIMGRYVLTPEIFMFLEQQHVGAGGEIQLTDAIQSLNE
IQRVFAYDFEGKRYDVGEKLGFVQTTIEMALQHPELRDDMVTMMKKILEEQTNQES
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
gtgatgaaaagagtaagaaaagcgataatcccagcagctggattaggaacacgtttttta
ccagctacaaaagcaatgccaaaagaaatgttaccgattgttgataaaccaactatccaa
tacattgtagaagaagcagtaaaatcaggaatcgaagatattattatcgttactggtaaa
acgaagcgttctattgaagatcattttgataatgcatttgagttagagcaaaacttatta
gaaaagaaaaagtatgagttacttgaaaaagtacaggcttcttcaaaaatggtagacatt
cactatatccgtcaaaaagaaccaaaaggattaggtcacgctgtttggtgtgcacgtaaa
ttcatcggtgatgagccatttgctgttttattaggtgatgatatcgttcaagctgaaaaa
ccatgtttacgtcaattaattgaagaatatgataaaacgctttcttctgttattggtgta
caaacggttccagaagacgaaacacaccgctacggaattattgatccgttagagcaagaa
ggacgtcgttaccaagttcgcaatttcgttgagaaaccagcagcaggtacagcaccttca
aacttagcaattatgggacgttacgttttaacacctgaaatcttcatgttcttagaacaa
caacatgttggtgctggtggtgaaatccagttaacagatgctattcaaagcttaaacgaa
attcaacgtgtattcgcttacgatttcgaaggaaagcgctacgacgtaggtgaaaagcta
ggattcgttcaaacgacaatcgaaatggcactgcaacacccagaattacgtgatgacatg
gttacgatgatgaagaaaattttagaagaacaaacgaatcaagagtcttaa

DBGET integrated database retrieval system